PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_30982_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 605aa    MW: 67592.8 Da    PI: 7.153
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_30982_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.5e-103934301954
                                           HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                              Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                           Fe   ++yps++++  LA+++gL+++qV++WF N R +
  cra_locus_30982_iso_1_len_2153_ver_3 393 FEHflHPYPSEADKHLLARQTGLSKNQVSNWFINARVR 430
                                           664559******************************88 PP

2BELL112.91.7e-36253324172
                                  BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                           er+e q++k+kLls+l+eVd rY +y+eq+q v+ssF++++g+g a+pYt lA+ka+SrhFr++kdai++qi
  cra_locus_30982_iso_1_len_2153_ver_3 253 ERAEYQRRKTKLLSMLDEVDGRYTHYCEQMQGVVSSFDTIIGHGGAAPYTILAQKAMSRHFRNIKDAIMGQI 324
                                           789*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.1E-62179322IPR006563POX domain
PfamPF075264.3E-45184321IPR006563POX domain
PROSITE profilePS5007112.617371434IPR001356Homeobox domain
SMARTSM003897.4E-10374438IPR001356Homeobox domain
CDDcd000861.99E-12374435No hitNo description
SuperFamilySSF466892.78E-17375440IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-29377439IPR009057Homeodomain-like
PfamPF059202.4E-18391430IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MKPPTAGDSW INRLQALEPQ QPQPQPPQVI YDTGGGMLTE VLHDFPAERG RKTAAVAAND  60
HLLELNDQIQ SSYKWPQKQQ LPLAINEDIE QLQFMHPQIV KPSSSPTNIE QQQPSSKFGQ  120
GLSLSLSSSQ QEFRMDNGGG IYLFDPGLGP TVNFNQVSMG ITDQVVHIGL PTSANSSSIR  180
MMNILRNSFY LKPAQELLEE FCCVGRGHMF KNSKVKIGNI NNNNNGSPNS NISNVNGGGG  240
GIYKERPPLS AAERAEYQRR KTKLLSMLDE VDGRYTHYCE QMQGVVSSFD TIIGHGGAAP  300
YTILAQKAMS RHFRNIKDAI MGQIKVTCEL LGEKDVTGTI GLTKGETPRL KLLDQKLRHQ  360
KSLHQLGMLD PEAWRPQRGL PERSVNILRA WLFEHFLHPY PSEADKHLLA RQTGLSKNQV  420
SNWFINARVR LWKPMVEEIY KEEAKEEEEV EETRTDEAAA NESKSSSSSS DKDHLNKTQN  480
MVISAAAIDD DHHHHQGKKR SEINAIEEND LSKNIINYGQ YSLGNEAIFV QGNNTTILIP  540
TTTAHHHHQY GINYMATTSN NRQGGGGGGD NVSLTLGLQH SDNILPRKRD FSILRNFGVY  600
RNDAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-17380438563Homeobox protein Meis2
3k2a_B4e-17380438563Homeobox protein Meis2
4xrm_A4e-17380438563Homeobox protein Meis2
4xrm_B4e-17380438563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009614985.11e-173PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-122BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLK4BV621e-157K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.11e-156(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721