PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_29310_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family Dof
Protein Properties Length: 304aa    MW: 32903.3 Da    PI: 9.3732
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_29310_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.51.6e-392987361
                                zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                          +++l+cprCdstntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk+s
  cra_locus_29310_iso_1_len_1135_ver_3 29 TENLRCPRCDSTNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKTS 87
                                          67899***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027016.4E-333186IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-253285IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5443286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MIHQESAASS GEIKVPKPIS PSSSPPAATE NLRCPRCDST NTKFCYYNNY NLTQPRHFCK  60
TCRRYWTKGG ALRNVPIGGG CRKNKTSSPI TSSSSSSSVA NKLSSNAVKL KTTTFSSSAE  120
IGKSTFISSL EHELYSSNSN PILWPNQNNS HLLSLLRPNP NLNPNPISSE SAVGRIFGLD  180
AFGLTVNPNS VWRNNNNHHQ QQQQQQNNGG VILGLEDFYQ RVRSSTSNQI NYQDASIIGG  240
NMGITTEAKS SSTLILESAP VGAGVGGTHE LMNYSNSSSW SNNNNPAVFS WSDLPTTHGT  300
AYPS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039230.15e-64PREDICTED: dof zinc finger protein DOF1.1-like isoform X1
RefseqXP_011039231.12e-64PREDICTED: dof zinc finger protein DOF1.1-like isoform X2
TrEMBLA0A068U1N51e-65A0A068U1N5_COFCA; Uncharacterized protein
STRINGPOPTR_0007s11620.11e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419