Plant Transcription Factor Database
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2881_iso_3
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family FAR1
Protein Properties Length: 813aa    MW: 93150.5 Da    PI: 7.9981
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                 FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk..................tekerrtra 56 
                                          +fY+eYAk++GFs  +++s++s+ +g++++++fvCs++gk++e+ +                   +++ r +r+
  cra_locus_2881_iso_3_len_2842_ver_3 155 SFYKEYAKSIGFSAIIKASRRSRISGKFIDAKFVCSRYGKKNESARLetpdslpgadgtmnistkKKRGRINRS 228
                                          5*****************************************9998899*************987777788*** PP

                                 FAR1  57 etrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                                           ++t+Cka+++vkk+++g+w + +l +eHnHe++p
  cra_locus_2881_iso_3_len_2842_ver_3 229 WSKTDCKACMHVKKRQEGRWTICNLIKEHNHEIFP 263
                                          ********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.5E-24155263IPR004330FAR1 DNA binding domain
PfamPF105518.2E-27378470IPR018289MULE transposase domain
PROSITE profilePS5096610.262657693IPR007527Zinc finger, SWIM-type
PfamPF044345.3E-8664691IPR007527Zinc finger, SWIM-type
SMARTSM005755.1E-7668695IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 813 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010649043.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X4
TrEMBLF6HF670.0F6HF67_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g01470.t010.0(Vitis vinifera)