PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2881_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family FAR1
Protein Properties Length: 838aa    MW: 95985.6 Da    PI: 7.9151
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2881_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR185.48.7e-27155263191
                                 FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk..................tekerrtra 56 
                                          +fY+eYAk++GFs  +++s++s+ +g++++++fvCs++gk++e+ +                   +++ r +r+
  cra_locus_2881_iso_2_len_2741_ver_3 155 SFYKEYAKSIGFSAIIKASRRSRISGKFIDAKFVCSRYGKKNESARLetpdslpgadgtmnistkKKRGRINRS 228
                                          5*****************************************9998899*************987777788*** PP

                                 FAR1  57 etrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                                           ++t+Cka+++vkk+++g+w + +l +eHnHe++p
  cra_locus_2881_iso_2_len_2741_ver_3 229 WSKTDCKACMHVKKRQEGRWTICNLIKEHNHEIFP 263
                                          ********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.6E-24155263IPR004330FAR1 DNA binding domain
PfamPF105518.5E-27378470IPR018289MULE transposase domain
PROSITE profilePS5096610.262657693IPR007527Zinc finger, SWIM-type
PfamPF044345.4E-8664691IPR007527Zinc finger, SWIM-type
SMARTSM005755.1E-7668695IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 838 aa     Download sequence    Send to blast
XAGGERVLSS ASNTVHQSCP NXRTEDTQPP NLTCFVHFSA AIFNSPLLHL YAIKNLGKKH  60
KISLPMGVDL EDPSCELSKD KEEDRSVANR GIEHAESGLC NKDSSMLSGY NKDDVGRTKT  120
AKQNSFDGAV MNMYSLRELE PHDRMEFESK EDALSFYKEY AKSIGFSAII KASRRSRISG  180
KFIDAKFVCS RYGKKNESAR LETPDSLPGA DGTMNISTKK KRGRINRSWS KTDCKACMHV  240
KKRQEGRWTI CNLIKEHNHE IFPDQACCFR DHRNADIGCS NIDRLDATHS RTKKMYMSSQ  300
TGLPMKVQNK KDGSMDTSGL HSALEEGDAQ LMLEYFSHMQ DENPNFFYAI DLNEEQRLRN  360
VFWVDAKGRL DYANFSDVVF LDTTYVKSEY KLPFVPFIGV NHHFQFVLLG CAMIGDESKS  420
TYVWLMQTWL RVMKQAPKVI LTDQDEVLKE TIAEVLKDSR HCFCLWHILS KIQEKLGYVI  480
TQHENFTTKF GKCILKSVSE EQFEKRWSKL VDGFDLRNDS WVQATYEDRF QWVPTYMKHI  540
FLAGMSTMQR LESLTSLFDK YMQRKTTLKE FFDQYKSMLK EKYEDEAKAD FETWHKKPGL  600
KSPSPFGKQM AALYTHAIFK KFQVEVLGVV ACHPKKESED GPNTKFKVQD FEENQDFIVV  660
WNDTIADASC SCQLFEYNGF LCRHIMIVLQ MFGIHNIPNK YILKRWTKNA KNREVIRTTG  720
LVKSPVERYN DICRRVLKLG DEASLSLETY NIAFNALKDA LRKCESLNCS IQYIAESSSP  780
SDHGLPEFEE VSAGGSTNKV TRGTNVSGNG ETQPEHEVVT AGMNSNWQRM VGYISALF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010649024.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_010649026.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_010649043.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X4
SwissprotQ9SWG30.0FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLF6HF670.0F6HF67_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g01470.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49621103