PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2810_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 238aa    MW: 27422.5 Da    PI: 10.0513
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2810_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.4e-191962146
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                        r ++T+eE+e+l+ a++ +G++ W++I+r ++ gRt++ +k++w+ 
  cra_locus_2810_iso_3_len_757_ver_3 19 RRPFTEEEEERLLAAHRIHGNK-WALISRLFP-GRTDNAVKNHWHV 62
                                        679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-9224IPR009057Homeodomain-like
SuperFamilySSF466891.71E-22269IPR009057Homeodomain-like
PROSITE profilePS5129427.3471468IPR017930Myb domain
SMARTSM007175.7E-161866IPR001005SANT/Myb domain
PfamPF002491.0E-151961IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-172563IPR009057Homeodomain-like
CDDcd001671.36E-73061No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
XGKSCRLRWF NQLDPRINRR PFTEEEEERL LAAHRIHGNK WALISRLFPG RTDNAVKNHW  60
HVIMARRQRE QSKLCGKRSY NELVISTTDP SNSPSFGFRR KYSRTQEDFG SKISFGNSSF  120
FYEEFQNPNR NSLFSVSTSS SPWMSCNQRY LLNSSVIGSY GNYKRAIMNP FGFPVCGDHG  180
KSEANGKNKR GLQVMNNIGH DHNCFPFGKS IEKKHNEDDQ SIPKEDIPFI DFLGVGIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-1926742107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769218.11e-71PREDICTED: transcription factor LAF1-like
RefseqXP_016506610.11e-71PREDICTED: transcription factor LAF1-like
TrEMBLA0A061FIQ04e-65A0A061FIQ0_THECC; Myb domain protein 52
STRINGVIT_18s0001g15260.t014e-63(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466