PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_27627_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 295aa    MW: 32545.8 Da    PI: 9.3292
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_27627_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.3e-32102155255
                              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  cra_locus_27627_iso_1_len_943_ver_3 102 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 155
                                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.36E-1599155IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.7E-29100155IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-24102155IPR006447Myb domain, plants
PfamPF002494.4E-7103154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
SSSSTPPYFD HLSILNSPNN PLSPAAAYRI TGGGGSTRFN GLSSSYLHHH QYGGGGGLGS  60
DHHHHHHHHQ SNISHHHHGM MMRSSSSRFL PKLPQKRSMR APRMRWTSTL HARFVHAVEL  120
LGGHERATPK SVLELMDVKD LTLAHVKSHL QMYRTVKTTD KPAASSGQSD GSGDEDLSTM  180
GSVGGGDRSG LRRLMDQRGP SDGQQESDYP STTTTLWSNS SSSREAWLQT NTGDMNGHRS  240
NSTHTPLLEQ RSPRQIIEEC DSSRTNSYLL SGLNHKNPSL EFTLGRPDWV EKEHA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-16103157357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-16103157357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-16103157357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-16103157357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027073674.11e-123transcription repressor KAN1-like
RefseqXP_027077554.11e-123transcription repressor KAN1-like
SwissprotQ0J2355e-63ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A068TZL41e-123A0A068TZL4_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000346631e-107(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355