PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2671_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 360aa    MW: 39904.5 Da    PI: 7.2636
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2671_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.33e-1292136147
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  cra_locus_2671_iso_3_len_1286_ver_3  92 RESWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 136
                                          789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.59E-1686142IPR009057Homeodomain-like
PROSITE profilePS5129414.1887141IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-590142IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-1890139IPR006447Myb domain, plants
SMARTSM007176.5E-1091139IPR001005SANT/Myb domain
PfamPF002495.6E-1092136IPR001005SANT/Myb domain
CDDcd001671.58E-794137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
RPGDAVVHRT DRLDNANISS TYCXQYMVSL NPNPPEDFYL DPMGMALPNL GSFSNPPATA  60
TSATTSTSTA PSLPSDDPTK KVRKPYTITK SRESWTEPEH DKFLEALQLF DRDWKKIEAF  120
VGSKTVIQIR SHAQKYFLKV QKGGTNEHLP PPRPKRKAAH PYPQKASKSA SALPQATPFH  180
ESTSLPDHGF LQRHDSSIVL KNPVTGVLSW NENSAGPVNL HPAEKGDIRP ASLPIANNNC  240
CSSNESTPHS KTRPTGDMTD QGNHGPQRVL PDFAQVYGFI GSVFDPNVTG HLQKLKKMDP  300
IDVETVLLLM RNLSINLTSP DFEDHRRLLS SYEIELGKED GNDPTNIIHD QRVDVSHFVT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076101.11e-146PREDICTED: protein REVEILLE 6-like isoform X1
SwissprotQ8H0W31e-110RVE6_ARATH; Protein REVEILLE 6
TrEMBLA1DR870.0A1DR87_CATRO; MYB transcription factor (Fragment)
STRINGSolyc06g036300.2.11e-139(Solanum lycopersicum)