PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2664_iso_9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 770aa    MW: 84145.7 Da    PI: 6.6183
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2664_iso_9genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-162468147
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  cra_locus_2664_iso_9_len_2838_ver_3 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171874IPR009057Homeodomain-like
PROSITE profilePS5129420.1731973IPR017930Myb domain
TIGRFAMsTIGR015577.1E-172271IPR006447Myb domain, plants
SMARTSM007171.1E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-82464IPR009057Homeodomain-like
PfamPF002493.2E-132467IPR001005SANT/Myb domain
CDDcd001671.50E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    Send to blast
MDPYSSGEEI VIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEALVKG VPIGQALDIE IPPPRPKRKP CNPYPRKISN GRTTCQVGSK  120
DEKSGIPVYS VSQAKHVLDL EKEPTPERNS DERIACAKEN QDENRNSGFV LLSTSPHTCP  180
SSANKSSMPT LAVPRKSCTF KEFVPVINEV VNKDETNESY VTVEPRENQY SAKSDTRQSF  240
PENGICDSMT LAKTHPVNEN LVVGKGQNLD QSKKETELKN DVQNMEGQPR HVPVHILDGS  300
LGMNAANVSF HMSSQQSMFH QMGGVHPNLF MNLSSSSTSE HQNSTPRFTI NQPFPGIHPI  360
VTPIQNQDDY QSLLHASSAF SSLIVSTLLQ NPAAHAAASF AASFWPCSSM EDPAGSAAGT  420
TGGFPVRQIN TTPSIAAIAA ATVAAATAWW AAHGVLPVCA PFHMSFNYAP ASAASTVPVG  480
ASQARADNSE RKEKTDAPAL ETAQMEAELS SEALQEQHST SKSPALSMSD SDEINGLKLH  540
NGSTAIETEK AVAAAQLHDN KAKGRKQVDR SSCGSNTPSS SEVETDALEK HEKGNEELRE  600
AAIDHPTGDS ISRRGRSSSG SNDSWKEVSE EGRLAFQALF SREVLPQSFS PPYDSMNNLE  660
KDKQTVDEKD TEGSPSRVDV SGKIGGVSCC SQPAEENVYL KGETNKLTAE GLLTMGKFKV  720
RHTGFKPYKR CSVEAQQQEC SRVVNTSSCQ DQEKGPKRIR LEAEASNLIP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661512.10.0PREDICTED: protein LHY-like isoform X3
RefseqXP_010661511.10.0PREDICTED: protein LHY-like isoform X3
TrEMBLA0A068UJ960.0A0A068UJ96_COFCA; Uncharacterized protein
STRINGVIT_15s0048g02410.t010.0(Vitis vinifera)