PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2664_iso_7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 744aa    MW: 81053.2 Da    PI: 6.4768
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2664_iso_7genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.17.3e-12442747
                                         HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  cra_locus_2664_iso_7_len_3106_ver_3  4 EEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 42
                                         9*************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.2E-4145IPR001005SANT/Myb domain
PROSITE profilePS5129418.189147IPR017930Myb domain
SuperFamilySSF466897.26E-11448IPR009057Homeodomain-like
CDDcd001672.41E-6443No hitNo description
Gene3DG3DSA:1.10.10.601.5E-4438IPR009057Homeodomain-like
PfamPF002492.3E-9441IPR001005SANT/Myb domain
TIGRFAMsTIGR015578.3E-12445IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MDWEEHNRFL EALKLYGRAW QRIEEHIGTK TAVQIRSHAQ KFFTKLEKEA LVKGVPIGQA  60
LDIEIPPPRP KRKPCNPYPR KISNGRTTCQ VGSKDEKSGI PVYSVSQAKH VLDLEKEPTP  120
ERNSDERIAC AKENQDENRN SGFVLLSTSP HTCPSSANKS SMPTLAVPRK SCTFKEFVPV  180
INEVVNKDET NESYVTVEPR ENQYSAKSDT RQSFPENGIC DSMTLAKTHP VNENLVVGKG  240
QNLDQSKKET ELKNDVQNME GQPRHVPVHI LDGSLGMNAA NVSFHMSSQQ SMFHQMGGVH  300
PNLFMNLSSS STSEHQNSTP RFTINQPFPG IHPIVTPIQN QDDYQSLLHA SSAFSSLIVS  360
TLLQNPAAHA AASFAASFWP CSSMEDPAGS AAGTTGGFPV RQINTTPSIA AIAAATVAAA  420
TAWWAAHGVL PVCAPFHMSF NYAPASAAST VPVGASQARA DNSERKEKTD APALETAQME  480
AELSSEALQE QHSTSKSPAL SMSDSDEING LKLHNGSTAI ETEKAVAAAQ LHDNKAKGRK  540
QVDRSSCGSN TPSSSEVETD ALEKHEKGNE ELREAAIDHP TGDSISRRGR SSSGSNDSWK  600
EVSEEGRLAF QALFSREVLP QSFSPPYDSM NNLEKDKQTV DEKDTEGSPS RVDVSGKIGG  660
VSCCSQPAEE NVYLKGETNK LTAEGLLTMG KFKVRHTGFK PYKRCSVEAQ QQECSRVVNT  720
SSCQDQEKGP KRIRLEAEAS NLIP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661519.10.0PREDICTED: protein LHY-like isoform X4
RefseqXP_010661518.10.0PREDICTED: protein LHY-like isoform X4
RefseqXP_010661517.10.0PREDICTED: protein LHY-like isoform X4
RefseqXP_010661513.10.0PREDICTED: protein LHY-like isoform X4
RefseqXP_010661512.10.0PREDICTED: protein LHY-like isoform X3
RefseqXP_010661511.10.0PREDICTED: protein LHY-like isoform X3
TrEMBLA0A068UJ960.0A0A068UJ96_COFCA; Uncharacterized protein
STRINGVIT_15s0048g02410.t010.0(Vitis vinifera)