PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2664_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 796aa    MW: 87273.6 Da    PI: 6.6893
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2664_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.5e-165094147
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  cra_locus_2664_iso_4_len_2916_ver_3 50 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 94
                                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.97E-1744100IPR009057Homeodomain-like
PROSITE profilePS5129420.1734599IPR017930Myb domain
TIGRFAMsTIGR015577.4E-174897IPR006447Myb domain, plants
SMARTSM007171.1E-124997IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-85090IPR009057Homeodomain-like
PfamPF002493.3E-135093IPR001005SANT/Myb domain
CDDcd001671.57E-95295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 796 aa     Download sequence    Send to blast
MDPYSSGEEI VIKVYFFTSQ KYCLIAILIL IFLVLLPWQT RKPYTITKQR ERWTEEEHNR  60
FLEALKLYGR AWQRIEEHIG TKTAVQIRSH AQKFFTKLEK EALVKGVPIG QALDIEIPPP  120
RPKRKPCNPY PRKISNGRTT CQVGSKDEKS GIPVYSVSQA KHVLDLEKEP TPERNSDERI  180
ACAKENQDEN RNSGFVLLST SPHTCPSSAN KSSMPTLAVP RKSCTFKEFV PVINEVVNKD  240
ETNESYVTVE PRENQYSAKS DTRQSFPENG ICDSMTLAKT HPVNENLVVG KGQNLDQSKK  300
ETELKNDVQN MEGQPRHVPV HILDGSLGMN AANVSFHMSS QQSMFHQMGG VHPNLFMNLS  360
SSSTSEHQNS TPRFTINQPF PGIHPIVTPI QNQDDYQSLL HASSAFSSLI VSTLLQNPAA  420
HAAASFAASF WPCSSMEDPA GSAAGTTGGF PVRQINTTPS IAAIAAATVA AATAWWAAHG  480
VLPVCAPFHM SFNYAPASAA STVPVGASQA RADNSERKEK TDAPALETAQ MEAELSSEAL  540
QEQHSTSKSP ALSMSDSDEI NGLKLHNGST AIETEKAVAA AQLHDNKAKG RKQVDRSSCG  600
SNTPSSSEVE TDALEKHEKG NEELREAAID HPTGDSISRR GRSSSGSNDS WKEVSEEGRL  660
AFQALFSREV LPQSFSPPYD SMNNLEKDKQ TVDEKDTEGS PSRVDVSGKI GGVSCCSQPA  720
EENVYLKGET NKLTAEGLLT MGKFKVRHTG FKPYKRCSVE AQQQECSRVV NTSSCQDQEK  780
GPKRIRLEAE ASNLIP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661512.10.0PREDICTED: protein LHY-like isoform X3
RefseqXP_010661511.10.0PREDICTED: protein LHY-like isoform X3
TrEMBLA0A068UJ960.0A0A068UJ96_COFCA; Uncharacterized protein
STRINGVIT_15s0048g02410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97101315