PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2619_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family ARF
Protein Properties Length: 697aa    MW: 77338 Da    PI: 6.3519
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2619_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.42.7e-23129229198
                                          EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHH CS
                                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFv 69 
                                          f+kvlt sd++++g +++ +k+a+e+     + ++  +++l+ +d++g +W +k+i+r++++r++lt+GW+ Fv
  cra_locus_2619_iso_1_len_3098_ver_3 129 FCKVLTASDTSTHGGFSVLRKHANEClppldMTQPVPTQELVAKDLHGIEWHFKHIFRGQPRRHLLTTGWSTFV 202
                                          99****************************9555556669********************************** PP

                                          HHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                                   B3  70 kangLkegDfvvFkldgrsefelvvkvfr 98 
                                           +++L +gD++vF   +  ++el+v+v+r
  cra_locus_2619_iso_1_len_3098_ver_3 203 TSKRLVAGDSFVFL--RGANGELRVGVRR 229
                                          **************..3489999****98 PP

2Auxin_resp103.23.2e-34255334183
                           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrW 74 
                                          a+ha+st++ F v+Y+Pr+  s+F++ ++k+++++++ + vGmRfkm+fe+ed +err++Gt+vgv+d++p +W
  cra_locus_2619_iso_1_len_3098_ver_3 255 ASHAVSTGTLFVVYYKPRT--SQFIIGLNKYLESINHGFGVGMRFKMQFEGEDTPERRFTGTIVGVEDMSP-QW 325
                                          789***************6..9*************************************************.** PP

                           Auxin_resp  75 pnSkWrsLk 83 
                                          ++SkWrsLk
  cra_locus_2619_iso_1_len_3098_ver_3 326 EKSKWRSLK 334
                                          *******96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.19E-40119258IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.4E-40121244IPR015300DNA-binding pseudobarrel domain
CDDcd100171.81E-21127229No hitNo description
PfamPF023622.4E-21129229IPR003340B3 DNA binding domain
PROSITE profilePS5086312.055129231IPR003340B3 DNA binding domain
SMARTSM010191.9E-22129231IPR003340B3 DNA binding domain
PfamPF065071.9E-31255334IPR010525Auxin response factor
PfamPF023093.7E-7565621IPR033389AUX/IAA domain
SuperFamilySSF542777.19E-13579661No hitNo description
PROSITE profilePS5174525.71585666IPR000270PB1 domain
PfamPF023091.9E-5631668IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 697 aa     Download sequence    Send to blast
MANSRGSFPQ QQHTNVLAEG PDDLYTELWK ACAGPLVDVP KVRERVYYFP QGHMEQLEAS  60
TNQELNQRIP MFNLSSKILC SVVDIQLLAE KETDEVYAQI TLIPEQDQTE PKSSDSYPSE  120
PPRPTVHSFC KVLTASDTST HGGFSVLRKH ANECLPPLDM TQPVPTQELV AKDLHGIEWH  180
FKHIFRGQPR RHLLTTGWST FVTSKRLVAG DSFVFLRGAN GELRVGVRRV DRQQSQMPSS  240
VISSHSMHLG VLATASHAVS TGTLFVVYYK PRTSQFIIGL NKYLESINHG FGVGMRFKMQ  300
FEGEDTPERR FTGTIVGVED MSPQWEKSKW RSLKVQWDEP ASIPRPERVS PWEIEPFVAA  360
IPTSVVPSGA GKNKRLRSHI ESPLAETVSS PVSAVWNPSQ DSTLVNGTPD GLRSQNISLH  420
PSHIDISANP ISGSRSCNIR THTEGDWLSP SHVNSSLSMF TDETETKSTL GWSTFSGTSA  480
TPPAKASDNS TSHLRDGWKP DATVATCRLF GIDLRSPSAG APGEREPLKP IITQDCATKE  540
CSLTTLSASD SERKSDLSKD SKDQMLGQPP LPSKEVQSKQ NCSTRSRTKV QMQGVAVGRA  600
VDLTNLKGYD ELMCELEEMF EIKGELRPRN KWEIVFTDDE GDMMLMGDDP WQEFCSMVRR  660
IFICSSHDVK KMRAGSKLPL PSTDNDGTAF SSETGED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1752235717355Auxin response factor 1
4ldw_A1e-1752235717355Auxin response factor 1
4ldw_B1e-1752235717355Auxin response factor 1
4ldx_A1e-1752235717355Auxin response factor 1
4ldx_B1e-1752235717355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027182958.10.0auxin response factor 9 isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A068UX670.0A0A068UX67_COFCA; Auxin response factor
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450