PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2560_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 356aa    MW: 40003.9 Da    PI: 5.9535
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2560_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.75.6e-332074155
                              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                         kprl+Wt+eLH+rFv+av+qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  cra_locus_2560_iso_5_len_1231_ver_3 20 KPRLKWTQELHQRFVDAVNQLGGADKATPKSLMRVMGIHGLTLYHLKSHLQKYRL 74
                                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.9171777IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-311876IPR009057Homeodomain-like
SuperFamilySSF466892.15E-161975IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-232075IPR006447Myb domain, plants
PfamPF002491.4E-82273IPR001005SANT/Myb domain
PfamPF143791.3E-21121168IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MTLQNLQNKD MNLVLSSDAK PRLKWTQELH QRFVDAVNQL GGADKATPKS LMRVMGIHGL  60
TLYHLKSHLQ KYRLGKSQQS QTYSEPKQEE QCEADEGENQ VTSQLSGEIC DKAQHQINES  120
MKIAQALQMQ MEVQRKLYEQ IEVQRHLQLR IEAQGKYLQS VLRKAQETLA GYNPSSAVGI  180
ELAKEELSQL VTMVDMGCCQ NSSLSALTDT DQENPILKHI ENKQQQFRSN GCSLESSLTS  240
SDQSSGLKEL AETRCGNDEN ENWTRQSVVL SLMEMQPGQK NGERKRMAAI SAKQQPSAKR  300
FQSQKSAADD DDQGERKFGF LETIDLNSKC IVSDFDSGTK IIDLNSKGVE QPNGYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-191976158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-191976158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-192076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-192076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-192076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-192076157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-191976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-191976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-191976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-191976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-191976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-191976158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027097729.11e-130myb family transcription factor PHL8-like isoform X1
TrEMBLA0A068TVN41e-109A0A068TVN4_COFCA; Uncharacterized protein
TrEMBLA0A2P6R2W11e-109A0A2P6R2W1_ROSCH; Putative sterol 14-alpha-demethylase transcription factor MYB-HB-like family
STRINGXP_008339891.11e-115(Malus domestica)