PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2560_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 260aa    MW: 29133.7 Da    PI: 7.0198
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2560_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.43.4e-332074155
                             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                        kprl+Wt+eLH+rFv+av+qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  cra_locus_2560_iso_1_len_943_ver_3 20 KPRLKWTQELHQRFVDAVNQLGGADKATPKSLMRVMGIHGLTLYHLKSHLQKYRL 74
                                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.9171777IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-311876IPR009057Homeodomain-like
SuperFamilySSF466891.25E-161975IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-232075IPR006447Myb domain, plants
PfamPF002498.9E-92273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MTLQNLQNKD MNLVLSSDAK PRLKWTQELH QRFVDAVNQL GGADKATPKS LMRVMGIHGL  60
TLYHLKSHLQ KYRLGKSQQS QTYSEPKQEE LSQLVTMVDM GCCQNSSLSA LTDTDQENPI  120
LKHIENKQQQ FRSNGCSLES SLTSSDQSSG LKELAETRCG NDENENWTRQ SVVLSLMEMQ  180
PGQKNGERKR MAAISAKQQP SAKRFQSQKS AADDDDQGER KFGFLETIDL NSKCIVSDFD  240
SGTKIIDLNS KGVEQPNGYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-212076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-212076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-212076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-212076157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-211976158Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A175YIC34e-50A0A175YIC3_DAUCS; Uncharacterized protein