PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2467_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 447aa    MW: 49519.9 Da    PI: 8.4715
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2467_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding431e-13226270347
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  cra_locus_2467_iso_2_len_1673_ver_3 226 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 270
                                          7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.5651932IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129413.306219275IPR017930Myb domain
SMARTSM007171.3E-8223273IPR001005SANT/Myb domain
SuperFamilySSF466892.09E-15225276IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-15225274IPR006447Myb domain, plants
CDDcd001674.85E-9226270No hitNo description
Gene3DG3DSA:1.10.10.609.3E-11226270IPR009057Homeodomain-like
PfamPF002497.1E-11226270IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MSSSLERKKG KTVIMLRSCS QCGSNGHNSR TCGESSSAAG NGAGDGEFML FGVRVKVDPM  60
RKSVSMNDLS QYELPSNVNQ NGVDNSKNSN DSDKVVADDV VTAGAGYVSA DDAVQHQSTG  120
GRELREVRSF YNFLLTYGFI DLLIFFNNSN LFFEIFELIP LSDWNLCQFV NFLKLICLLK  180
FSCXVLYIYS FDFGKSNSMQ RFCFEFLDLT VGFAHLSVDF LILGIPWTEE EHKLFLLGLQ  240
KVGKGDWRGI SRNFVKTRTP TQVASHAQKY YLRKNNLNRR RRRSSLFDIT TDSVPGGLPM  300
DDVKNHQDKS VPKVLQHSQV PHAEKPNMNG YTIAPFPLAV GPILLPVQVH NPMENKAFHW  360
GDHQLQNGPG MLLRTVPFIP VANSSSAIRD LNLNQRVEGE PSSPLSLKLS LSSSDNSQSS  420
STRHSTGFQA MAATSFSKGG DSIISVA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071772.11e-55PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B06e-47MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA1DR861e-134A1DR86_CATRO; MYB transcription factor
STRINGVIT_01s0026g01050.t011e-52(Vitis vinifera)