PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2466_iso_8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 281aa    MW: 30305.7 Da    PI: 6.6676
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2466_iso_8genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.21.5e-2257971555
                              G2-like 15 veaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                         v+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  cra_locus_2466_iso_8_len_1781_ver_3 57 VDAVTQLGGPSKATPKAIMRTMGVKGLTLFHLKSHLQKYRL 97
                                         9***************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.38E-75798IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-145797IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.2E-195798IPR009057Homeodomain-like
PfamPF143792.0E-14127172IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MQMLPRLIQP REAIIAQEDI HNLHTSAAAG IVDPCLVLTS DPSLASAGLR TFTXXXVDAV  60
TQLGGPSKAT PKAIMRTMGV KGLTLFHLKS HLQKYRLGLA ASHLIESPCA SNSAQSLQTS  120
DINEGYEVKE ALRAQMEVQS KLHLQVEAEK HLHIRQDAEQ KYMVMLERAC KMLVEQMVGC  180
AITNSDGEDY HQVIGRKTST SGTSPIACGL DPSESNDIVR VQGSQEYITR INPQGADCST  240
ESCLTSHDST AGATLDGSLP GGEGKKRILS RNSASPSIIW S
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027086327.11e-109protein PHR1-LIKE 3-like isoform X2
RefseqXP_027185319.11e-109protein PHR1-LIKE 3-like isoform X2
TrEMBLA0A068U7M81e-104A0A068U7M8_COFCA; Uncharacterized protein
STRINGEMJ128778e-99(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97642027