PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2466_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 276aa    MW: 30018.8 Da    PI: 7.2363
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2466_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.23.1e-27249451
                              G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                                         lrWt +LH+rFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQ
  cra_locus_2466_iso_4_len_1504_ver_3  2 LRWTADLHDRFVDAVTQLGGPSKATPKAIMRTMGVKGLTLFHLKSHLQ 49
                                         79********************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.462156IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-24249IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-20253IPR006447Myb domain, plants
SuperFamilySSF466896.63E-12252IPR009057Homeodomain-like
PfamPF002498.5E-6349IPR001005SANT/Myb domain
PfamPF143792.0E-14122167IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
XLRWTADLHD RFVDAVTQLG GPSKATPKAI MRTMGVKGLT LFHLKSHLQV CFSVRLKLIS  60
LVSGSFDRDL LLLQKYRLGK QSGKDLGEAS KDGLAASHLI ESPCASNSAQ SLQTSDINEG  120
YEVKEALRAQ MEVQSKLHLQ VEAEKHLHIR QDAEQKYMVM LERACKMLVE QMVGCAITNS  180
DGEDYHQVIG RKTSTSGTSP IACGLDPSES NDIVRVQGSQ EYITRINPQG ADCSTESCLT  240
SHDSTAGATL DGSLPGGEGK KRILSRNSAS PSIIWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-14257560Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-14257560Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-14249451Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-14249451Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-14249451Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-14249451Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-14257560Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-14257560Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-14257560Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-14257560Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-14257560Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-14257560Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027086326.11e-111protein PHR1-LIKE 3-like isoform X1
RefseqXP_027185318.11e-111protein PHR1-LIKE 3-like isoform X1
TrEMBLA0A068U7M81e-109A0A068U7M8_COFCA; Uncharacterized protein
STRINGXP_004293427.11e-106(Fragaria vesca)