PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2466_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 243aa    MW: 26586.8 Da    PI: 6.7835
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2466_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.25.7e-31253455
                              G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                         lrWt +LH+rFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  cra_locus_2466_iso_3_len_1404_ver_3  2 LRWTADLHDRFVDAVTQLGGPSKATPKAIMRTMGVKGLTLFHLKSHLQKYRL 53
                                         79*************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.792156IPR017930Myb domain
TIGRFAMsTIGR015571.9E-22253IPR006447Myb domain, plants
SuperFamilySSF466891.31E-14254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-28254IPR009057Homeodomain-like
PfamPF002492.1E-7352IPR001005SANT/Myb domain
PfamPF143791.6E-1489134IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
XLRWTADLHD RFVDAVTQLG GPSKATPKAI MRTMGVKGLT LFHLKSHLQK YRLGLAASHL  60
IESPCASNSA QSLQTSDINE DEILFRGYEV KEALRAQMEV QSKLHLQVEA EKHLHIRQDA  120
EQKYMVMLER ACKMLVEQMV GCAITNSDGE DYHQVIGRKT STSGTSPIAC GLDPSESNDI  180
VRVQGSQEYI TRINPQGADC STESCLTSHD STAGATLDGS LPGGEGKKRI LSRNSASPSI  240
IWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16252555Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16252555Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-16252454Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16252454Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16252454Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16252454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16252555Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16252555Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16252555Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16252555Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16252555Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16252555Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027086327.11e-105protein PHR1-LIKE 3-like isoform X2
RefseqXP_027185319.11e-105protein PHR1-LIKE 3-like isoform X2
TrEMBLA0A068U7M81e-100A0A068U7M8_COFCA; Uncharacterized protein
TrEMBLA0A1U8GT661e-100A0A1U8GT66_CAPAN; uncharacterized protein LOC107870086 isoform X2
STRINGXP_004293427.19e-98(Fragaria vesca)