PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_23821_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 328aa    MW: 34994.9 Da    PI: 9.3229
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_23821_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.9e-13112156347
                                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                           +WT+eE+ l++ + ++ G+g+W+ I++ + k+Rt+ q+ s+ qky
  cra_locus_23821_iso_1_len_1180_ver_3 112 PWTEEEHRLFLLGLQKVGKGDWRGISKNFVKTRTPTQVASHAQKY 156
                                           7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.46105161IPR017930Myb domain
SuperFamilySSF466893.14E-17107162IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-17108159IPR006447Myb domain, plants
SMARTSM007171.1E-9109159IPR001005SANT/Myb domain
PfamPF002494.7E-11112156IPR001005SANT/Myb domain
CDDcd001671.37E-9112157No hitNo description
Gene3DG3DSA:1.10.10.602.3E-11112156IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
XFAVIMSSSC SLCGNEGHSS NTCSDVVGGG GAVAADGGSC GKGFMLFGVR LMAVADGGGS  60
GFRKCASMNN LAQFDHQQQP HDVSNDVINP GYASDDVVHP SAGSRERKRG IPWTEEEHRL  120
FLLGLQKVGK GDWRGISKNF VKTRTPTQVA SHAQKYFLRR NNHNRRRRRS SLFDITTDTV  180
LKPAAVEDRS TQDSVPPQLP TAAQQQNLIN NLQKFHTSGG SYPINFTPAD LLVTGAKSSE  240
NFTSGKFCQI PLAPPPPVPP SSKMADLNLN KTTIITDPLP LSLKLSASSP PPSSPDQKSS  300
SAARHPSAFQ AMPNSFDSNS GDSIISVA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00630PBMTransfer from PK17526.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086441.16e-96PREDICTED: transcription factor MYB1R1
TrEMBLA0A068TW551e-108A0A068TW55_COFCA; Uncharacterized protein
STRINGVIT_01s0026g01050.t012e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114232225