PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2379_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family BES1
Protein Properties Length: 364aa    MW: 39258.1 Da    PI: 7.4655
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2379_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822190.94.6e-59401841148
                               DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgsk 74 
                                          ++++r ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+k
  cra_locus_2379_iso_2_len_1463_ver_3  40 TSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWIVEEDGTTYRKGCK 113
                                          5899********************************************************************** PP

                               DUF822  75 pleeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasa.....asllpvlsvl 143
                                          p  e +  g                      p++sy++sp+sssfpsp+s++ + ++ +     +sl+p+l++l
  cra_locus_2379_iso_2_len_1463_ver_3 114 PA-EXHGYGXXXXXXXXXXX-------XXXXPIASYNPSPSSSSFPSPVSSQYAAANVNntadaNSLIPWLKNL 179
                                          **.55555555555554443.......4799*****************99887655544567779********9 PP

                               DUF822 144 slvss 148
                                          s+ ss
  cra_locus_2379_iso_2_len_1463_ver_3 180 SSGSS 184
                                          98544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.0E-6041180IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
XPGPIKPASL FPAGLQNCSS EQSXAERELP EELERHRQMT SGTRLPTWKE RENNKRRERR  60
RRAIAAKIFA GLRMYGNYKL PKHCDNNEVL KALCNEAGWI VEEDGTTYRK GCKPAEXHGY  120
GXXXXXXXXX XXXXXXPIAS YNPSPSSSSF PSPVSSQYAA ANVNNTADAN SLIPWLKNLS  180
SGSSPASSKL HHNLYIPSGS ISAPVTPPLS SPTARTPRMQ DGWNDNAGSA WASPQFAFLP  240
SSTPSSPGRL TPPDSGWLSG VQTPNDGPSS PTFSLVASNP FGTKEPFSNG GSRMWTPGQS  300
GTCSPAIAAG FDQTADVPMT DAVSAEFAFG SNTKGLVKPW EGERIHEECV SDDLELTLGN  360
PSTR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101448.11e-157PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-117BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A022QJK11e-145A0A022QJK1_ERYGU; Uncharacterized protein
TrEMBLA0A022QNS21e-144A0A022QNS2_ERYGU; Uncharacterized protein
STRINGSolyc03g005990.2.11e-144(Solanum lycopersicum)
STRINGPGSC0003DMT4000715111e-144(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19842464