PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_23355_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 401aa    MW: 44074.2 Da    PI: 7.7908
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_23355_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-32293348156
                               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                           k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  cra_locus_23355_iso_1_len_1202_ver_3 293 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 348
                                           68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.204290350IPR017930Myb domain
SuperFamilySSF466895.73E-17291351IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-28291351IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-26293348IPR006447Myb domain, plants
PfamPF002496.6E-7295346IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
EEKLKLMMAS PSELSLECKT QYSCSMLLKS VGGEQSDIQT QKLEDFLARL EEERLKIDAF  60
KRELPLCMQL LTNAMEASRQ QLHSYRANNN EGPKPILEEF IPLKHHNPAI SEGSEKTNNN  120
NTNVNVVSDK ANWMTSAQLW SQASSGGTSA GGVDHEIIAK QQQQSPAAAV TSPKESDDHM  180
GFGVNLKQSE NNNNNNNQRN GNGNGGGGFL PFSKERNLNR GGAVVVPELA LSSTDHHHNH  240
HEIMEEKKII NSEGTSSDNM MMMMRRDQNL LGNNNNKSAA GESQTTTNQS HRKARRCWSP  300
DLHRRFVNAL QMLGGSQVAT PKQIRELMKV DGLTNDEVKS HLQKYRLHTR RPSPSPQSAA  360
AAAPQLVVLG GIWVPPEYAT AAAAHHAGGP PTLYPTTHSS P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-14293346255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-14293346255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-14293346154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-14293346154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-14293346154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-14293346154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-14293346255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-14293346255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-14293346255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-14293346255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-14293346255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-14293346255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017422950.11e-137PREDICTED: myb family transcription factor EFM
SwissprotQ9ZQ851e-112EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A218W1071e-136A0A218W107_PUNGR; Uncharacterized protein
STRINGXP_004508555.11e-133(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87942229
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]