PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_22369_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family RAV
Protein Properties Length: 357aa    MW: 40414.1 Da    PI: 8.7946
Description RAV family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_22369_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP227.58e-0976123154
                                   AP2   1 sgykGVrwdkkrgrWvAeIrdpsengkr.krfslgkfgtaeeAakaaiaarkkle 54 
                                           s+ kGV     +g W A+I+       + +r++lg+f ++ eAa a++ a  kl+
  cra_locus_22369_iso_2_len_1638_ver_3  76 SKLKGVVLQQ-NGHWGAQIYA------NhQRIWLGTFKSEVEAAMAYDSASIKLR 123
                                           6889998777.8******999......44**********99*********99997 PP

2B386.52.2e-27194294185
                                           EEEE-..-HHHHTT-EE--HHH.HTT.............---........--SEEEEEETTS-EEEEEE..EE CS
                                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.............ggkke......esktltledesgrsWevkliyrk 54 
                                           f k+ltpsdv+k++rlv+pkkfa  +             +   e       +++l++ d++ rsW+++++y+k
  cra_locus_22369_iso_2_len_1638_ver_3 194 FHKELTPSDVGKLNRLVIPKKFAVMYfpripesgednnsE---EnaaagvDDTELVFFDRTMRSWKFRYCYWK 263
                                           89**************************999998765541...14556667789******************* PP

                                           ETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                                    B3  55 ksgryvltkGWkeFvkangLkegDfvvFkld 85 
                                           +s+++v+t+GW++Fvk++gL+++D+++F++ 
  cra_locus_22369_iso_2_len_1638_ver_3 264 SSQSFVFTRGWNRFVKDKGLRAKDMIIFSFC 294
                                           ****************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000189.56E-2276134No hitNo description
PfamPF008472.8E-476123IPR001471AP2/ERF domain
SuperFamilySSF541712.81E-1476133IPR016177DNA-binding domain
PROSITE profilePS5103215.97577132IPR001471AP2/ERF domain
SMARTSM003801.6E-1477138IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.101.3E-1478132IPR001471AP2/ERF domain
Gene3DG3DSA:2.40.330.108.0E-31191297IPR015300DNA-binding pseudobarrel domain
CDDcd100171.79E-23192293No hitNo description
SuperFamilySSF1019361.09E-26193296IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.858194312IPR003340B3 DNA binding domain
PfamPF023622.2E-24194294IPR003340B3 DNA binding domain
SMARTSM010192.9E-21194302IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MASSISSARY QLLLFPVGKT RTNHSSNLPA RLSMEEQSEI SMAATNFTKE MSDSSSSSYL  60
IQNSKRPKMD PNSSSSKLKG VVLQQNGHWG AQIYANHQRI WLGTFKSEVE AAMAYDSASI  120
KLRSGDSHRN FPWTNITIEE PNFQSRFSTE IVLNMIKDGS YSSKFLDYLR ADSKTGQDLV  180
TSTQNGTLFC KKLFHKELTP SDVGKLNRLV IPKKFAVMYF PRIPESGEDN NSEENAAAGV  240
DDTELVFFDR TMRSWKFRYC YWKSSQSFVF TRGWNRFVKD KGLRAKDMII FSFCECKGGG  300
NNEQMQSLFM IDVGYYEGVV HGGGLVQNEN TAFVEENDSQ ETESNGSRKK GFRLFGX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A5e-2519030510110DNA-binding protein RAV1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027067685.11e-143AP2/ERF and B3 domain-containing transcription factor At1g51120-like
SwissprotQ9C6881e-102RAVL3_ARATH; AP2/ERF and B3 domain-containing transcription factor At1g51120
TrEMBLA0A068V5021e-142A0A068V502_COFCA; Uncharacterized protein
STRINGVIT_11s0037g00010.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52522339