PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2093_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 288aa    MW: 33002.4 Da    PI: 9.8911
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2093_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.71.4e-2960114155
                              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                          k+rl+Wt+eLH+ F +av+qLGG+++AtPk il++m++ gLt+ hvkSHLQkYR+
  cra_locus_2093_iso_4_len_1109_ver_3  60 KERLKWTQELHSLFEKAVNQLGGPDRATPKGILKAMGISGLTIFHVKSHLQKYRM 114
                                          68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.56757117IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2759115IPR009057Homeodomain-like
SuperFamilySSF466892.51E-1659114IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-2360115IPR006447Myb domain, plants
PfamPF002492.6E-962113IPR001005SANT/Myb domain
PfamPF143796.1E-18147190IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0042393Molecular Functionhistone binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
XSTQLNSTQM PIAYLTFSLQ QVYMCCSHLQ KKLPQIFHST GRVRRSRGCS MGSSRSDGSK  60
ERLKWTQELH SLFEKAVNQL GGPDRATPKG ILKAMGISGL TIFHVKSHLQ KYRMSKFIPE  120
SPHRGSRFER RSISEMLPNF SATSGAQLNE ALQMQLEVQR RLSDQFEVQR SLKMKIEAQG  180
RFLERIAEEC KNRSANAKPS KPYSPVSLPS LCEESDSEID RHEIRCTEEF RAPKRIRIED  240
DFMQQKYNNH NMLLQKGLNS PCWANDIGFP WNFAAQSPLL PALYDSLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2060117259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2060117259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-2060117158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-2060117158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-2060117158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-2060117158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2060117259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2060117259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2060117259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2060117259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2060117259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2060117259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027069043.11e-137myb family transcription factor PHL7-like
SwissprotQ9SJW05e-53PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A068UDA61e-136A0A068UDA6_COFCA; Uncharacterized protein
STRINGXP_006481047.12e-98(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101012026