PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_19353_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 299aa    MW: 32245.2 Da    PI: 8.2706
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_19353_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.44.5e-3098151155
                               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                           +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  cra_locus_19353_iso_2_len_1038_ver_3  98 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 151
                                           59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.06195154IPR017930Myb domain
SuperFamilySSF466891.36E-1995155IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-3097156IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2399151IPR006447Myb domain, plants
PfamPF002495.0E-8101150IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
XGNSHHSQAL SSSNNLKSFN LNDEATTITA TRSRDQMGMD IDETDLIREG SDSRKTRRIT  60
EGGATEEADS SAAARNTNNN SNNNETGADD GSARTLKRPR LVWTPQLHKR FVDVVAHLGI  120
KNAVPKTIMQ LMNVEGLTRE NVASHLQKYR LYLKRMQGLS TEGPSPSDHL FASTPVPQSL  180
HESAGGGSGG GGSAHGHGQG HSHGHAHANG NGNGHMGMPI PMPYPPPNGA QMVSVPMIGM  240
AGHMGIPGPT PGGYHGYESH HHHHHHHHQY GMVQQQRDWS GNKFGPVTPY SHHVTPNDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-3498154157Transcription factor LUX
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027184783.11e-122transcription factor LUX
TrEMBLA0A068UN941e-124A0A068UN94_COFCA; Uncharacterized protein
STRINGVIT_06s0004g05120.t015e-88(Vitis vinifera)