PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_18283_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family FAR1
Protein Properties Length: 894aa    MW: 102119 Da    PI: 7.4237
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_18283_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR189.45e-28137224191
                                  FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekd 73 
                                           +fY+eYAk++GF++++++s++sk+++e+++++f Cs++g + e++ +   ++r+ ++++t+Cka+++vk++kd
  cra_locus_18283_iso_3_len_3316_ver_3 137 SFYQEYAKSMGFTTSIKNSRRSKKSKEFIDAKFACSRYGVTPESDGT---SSRRASVKKTDCKASMHVKRKKD 206
                                           5****************************************999888...8889999**************** PP

                                  FAR1  74 gkwevtkleleHnHelap 91 
                                           gkw+v+++ +eHnHel p
  cra_locus_18283_iso_3_len_3316_ver_3 207 GKWYVHEFIKEHNHELLP 224
                                           ***************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.8E-26137224IPR004330FAR1 DNA binding domain
PfamPF105515.8E-26342435IPR018289MULE transposase domain
PROSITE profilePS509669.99622658IPR007527Zinc finger, SWIM-type
PfamPF044342.9E-7624657IPR007527Zinc finger, SWIM-type
SMARTSM005758.3E-9633660IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 894 aa     Download sequence    Send to blast
XNLLTTDXSG RGPILHPPLS TCVAADHFYA QTVVICSATV DLRAKRNCFC DILQPGHFVF  60
CRKGISEGSS EMHLGAWCGE EVXIAVVMIG NMVDVVDHAR DRNARHSPQR DMVGTSGDTE  120
FEPHDGIEFE SHEAAYSFYQ EYAKSMGFTT SIKNSRRSKK SKEFIDAKFA CSRYGVTPES  180
DGTSSRRASV KKTDCKASMH VKRKKDGKWY VHEFIKEHNH ELLPALAYHF RIHRNVKLAE  240
KNNIDILHAV SERTRKMYVE MSRQSGGNPD IDFLRNSFKH EGRQCLTLEE GDAQVMLEYF  300
MHVQRENPYF FYAMDLNEDQ RLRNLFWVDA KSRKDYNSFS DVILFDTSYI KSNEKMPFAP  360
FVGVNNHSQP MLLGCALIAD ESTSTIVWLM KTWLRAMGGQ PPKVIITDQG KTLRAAIAEI  420
FPQSRHCYAL WHILEKVPEI LAHVIKQHET FLGKLHKCIF KSLNDEDFDM RWWKMIGRFE  480
LQENEWVHSL YEDRKKWVPA FTKDAFLAGL STNQRSDSVT SFFDKYIHKK ISLKEFVRQY  540
GTILQNRYEE EAIADFDTWH KQPALKSPSP WEKQMSAIYT HAIFKKFQVE VLGVVGCHPK  600
KESVSGTDIS FRVDDCEKGE NFIVTWNEEA LNVSCSCLMF ESKGFLCRHA LIVLQMCGLS  660
SIPSQYILKR WTKDAKNRPT ILDGTERNQT RVQRYNDICR RAIELGEEGS LSEESYNIAF  720
RALVEGLKNC VDVNNKSAVE CSSNPVGLRD VEEDNQDIHS KSSKKKSTNK KRRVQPDSEA  780
AIVEVQGSLH PMENLNSDTM TLNGYYGTQQ NVPGLIQLNL MEPPREGYYV NQQNMQGLGQ  840
LSSIAPSHDG FYATPQSIPA LGHLDFRPPS FTYSLQDEAN VRSSQLHGGT ARHT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00434DAPTransfer from AT4G15090Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767065.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_009767066.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_016495821.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_016495822.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_016495823.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_016495824.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_016495825.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_016495826.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_016495827.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
SwissprotQ9SWG30.0FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLK4CKM90.0K4CKM9_SOLLC; Uncharacterized protein
STRINGSolyc08g060840.1.10.0(Solanum lycopersicum)