PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_18189_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 274aa    MW: 31127.3 Da    PI: 8.5095
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_18189_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-17853148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         rg+++ +E++ +++++++lG++ W++Ia++++ +Rt++++k++w+++l
  cra_locus_18189_iso_1_len_821_ver_3  8 RGNFSLQEEQTIIQLHALLGNR-WSAIASHLP-KRTDNEIKNYWNTHL 53
                                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-25157IPR009057Homeodomain-like
SuperFamilySSF466892.62E-15263IPR009057Homeodomain-like
PROSITE profilePS5129425.325357IPR017930Myb domain
SMARTSM007174.6E-17755IPR001005SANT/Myb domain
PfamPF002493.4E-16853IPR001005SANT/Myb domain
CDDcd001678.85E-131053No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
YLRPDIKRGN FSLQEEQTII QLHALLGNRW SAIASHLPKR TDNEIKNYWN THLKKRLTKM  60
GIDPMTHKPK NNALDSSQSK DTANLNHMAQ WESARVEAEA RLVRTAATSI NNPYHFRQCV  120
IPNPNTISLT KDSLLSLPPL GKPPLPSLDT LKASERSSWT NINLHFNVRT LLSPTSVLLP  180
PPFPDNIFTS NNKVAITKEN HAQFRNIMKE GMELQEIMGS SFPHNQVDDH HHVGLLMNPS  240
LLEGSFKFPH EDLLSDDHQV FNNINGVLYD NINL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158642.14e-61hypothetical protein PHAVU_002G170000g
TrEMBLA0A068VKQ32e-63A0A068VKQ3_COFCA; Uncharacterized protein
STRINGGLYMA07G35561.13e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154