PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_17679_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family ERF
Protein Properties Length: 197aa    MW: 21492.9 Da    PI: 5.1446
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_17679_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP238.43e-12831201655
                                   AP2  16 vAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 
                                           +AeIrdp +ng  +r++lg+f tae+Aa a+++a+ +++g
  cra_locus_17679_iso_1_len_1021_ver_3  83 AAEIRDPAKNG--ARVWLGTFETAEDAALAYDRAAYRMRG 120
                                           69*****9987..*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5103218.55864128IPR001471AP2/ERF domain
SuperFamilySSF541717.19E-1778130IPR016177DNA-binding domain
Gene3DG3DSA:3.30.730.105.3E-2379128IPR001471AP2/ERF domain
CDDcd000181.52E-2180128No hitNo description
SMARTSM003802.2E-2280134IPR001471AP2/ERF domain
PfamPF008471.6E-684120IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009864Biological Processinduced systemic resistance, jasmonic acid mediated signaling pathway
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051301Biological Processcell division
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MYENGDFDAD LALLDSIRRH LLGESLSESP GTFSGESPTG MYGGSGKDSE EQMLIYSFLN  60
EATTITAVKM EPGSEKAAVG KIAAEIRDPA KNGARVWLGT FETAEDAALA YDRAAYRMRG  120
SRALLNFPLR INSGEPEPVR ITSKRSNSNS NSSTSSPSNS PSLKRKKAIK VAEPPVLVVE  180
QDTEHRGYGE QRLFSEW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2gcc_A8e-32801351570ATERF1
3gcc_A8e-32801351570ATERF1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtActs as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways. Involved in disease resistance pathways. {ECO:0000269|PubMed:10715325, ECO:0000269|PubMed:12805630, ECO:0000269|PubMed:9756931}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00548DAPTransfer from AT5G47220Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) and Alternaria brassicicola (locally and systemically). Ethylene induction is completely dependent on a functional ETHYLENE-INSENSITIVE2 (EIN2) while wounding induction does not require EIN2. Transcripts accumulate strongly in cycloheximide-treated plants, a protein synthesis inhibitor. Seems to not be influenced by exogenous abscisic acid (ABA), cold, heat, NaCl or drought stress. {ECO:0000269|PubMed:10715325, ECO:0000269|PubMed:12805630}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028112381.12e-49ethylene-responsive transcription factor 1A-like
SwissprotO803381e-42EF101_ARATH; Ethylene-responsive transcription factor 2
TrEMBLA0A068UQX41e-53A0A068UQX4_COFCA; Uncharacterized protein
STRINGEOY242331e-45(Theobroma cacao)
STRINGGLYMA17G15480.19e-46(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21241165
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]