PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_17603_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family BES1
Protein Properties Length: 300aa    MW: 32842.9 Da    PI: 9.4601
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_17603_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822211.42.3e-6521372134
                                DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgsk 74 
                                           +++rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++
  cra_locus_17603_iso_2_len_1322_ver_3   2 SGRRKPSWRERENNRRRERRRRAIAAKIYSGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVEADGTTYRKGCR 74 
                                           799********************************************************************** PP

                                DUF822  75 pleeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasa....a 134
                                           p+   e++g+s++++p+ss + s+ ss++asp++sy++sp sss psp++ d ++++++     
  cra_locus_17603_iso_2_len_1322_ver_3  75 PP-PIEMGGTSTNITPSSSRNPSPPSSYFASPIPSYQPSPLSSSCPSPTRHDANPASHPfaflR 137
                                           **.9*************************************************99986544442 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.4E-612126IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
SSGRRKPSWR ERENNRRRER RRRAIAAKIY SGLRAQGNYN LPKHCDNNEV LKALCAEAGW  60
IVEADGTTYR KGCRPPPIEM GGTSTNITPS SSRNPSPPSS YFASPIPSYQ PSPLSSSCPS  120
PTRHDANPAS HPFAFLRNVI PSTLPPLRIS NSAPVTPPLS SPTRLPMQTF NLEALAKESM  180
SALNIPFFAA SAPASPTRAQ RFTPATIPEC DESDSSTIDS GQWMNFQTYT TNTVPTSPTF  240
NLMKPMVHQQ APSGNAVMDK GKGTEFDFEK LTVKAWEGER IHEVGLDDLE LTLGSGNGRI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1322RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-158PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-115BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A068UH771e-161A0A068UH77_COFCA; Uncharacterized protein
STRINGSolyc04g079980.2.11e-150(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454