PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_17221_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 359aa    MW: 41168.9 Da    PI: 7.7721
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_17221_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.2e-3270123255
                               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                           prlrWtp+LH rFv+ave+LGG+++AtPk +l+lm++kgL ++hvkSHLQ+YR+
  cra_locus_17221_iso_1_len_1410_ver_3  70 PRLRWTPDLHLRFVHAVERLGGQDRATPKLVLQLMNIKGLNIAHVKSHLQMYRS 123
                                           8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.35466126IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-3066124IPR009057Homeodomain-like
SuperFamilySSF466899.85E-1568124IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-2270124IPR006447Myb domain, plants
PfamPF002491.3E-871122IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MEGSGDTTEC SKNSKNEDED ECYEEEDEKF DEQKQKKLDG GSSSNSTVDE NNNHHDKKPS  60
VRPYVRSKMP RLRWTPDLHL RFVHAVERLG GQDRATPKLV LQLMNIKGLN IAHVKSHLQM  120
YRSKRIDDPS LGIGDHRHLF EGAADRNIYN LSQLPMLRGF NQNHSSPPFR YNRDACWNGL  180
QNLMHNTSMG QSTINKMRIL GSNYSRIMDS SQGSSWKKDE LKSFLDKEAW KGNYNHMDQL  240
KTLKHQEKKS RIDHIQDLMI TSSSNTNSSR LEKEGVRKRK AITESDEIDL TLSLRLGTKT  300
EDEDSFGSQL EDSDNESISY LSLSLFSPSS SSKKIRRRMK EDEIIRENGK GASTLDLTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-1771125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1771125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1771125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1771125357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095220.14e-91uncharacterized protein LOC105174731
TrEMBLA0A068UFP05e-89A0A068UFP0_COFCA; Uncharacterized protein
STRINGEOY071175e-80(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141