PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_17006_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family GATA
Protein Properties Length: 544aa    MW: 59963.1 Da    PI: 7.0509
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_17006_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.46.2e-16741135
                                  GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                                          C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  cra_locus_17006_iso_1_len_2395_ver_3  7 CYHCGVTSTPLWRNGPPEKPILCNACGSRWRTKGT 41
                                          ****************66666***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.7E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.04E-11545No hitNo description
CDDcd002023.32E-17654No hitNo description
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.3E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF003201.0E-13741IPR000679Zinc finger, GATA-type
PfamPF139198.8E-10284369IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPILCN ACGSRWRTKG TLANYTPLHA RAEPDDFEDY  60
RTSRLKTIST KNKEAKVHKR KQIQDNADFG VFASDSSQGF RKALDEDTSN RSSSGSAISN  120
SESCAQFGSA EASDLTGPAQ PMVWDSMVPS RKRTCVNRPK PSSVEKLSKD LYTILHEQQS  180
YFSGSSEEDL LFETDKPMVS VEIGHGSVLI RHPSTIAREE ESEASSLSVD NKLHTPNEAY  240
SRLTPFPVHN NNFSKGVDLP SPGIEKNKKP TGQGTEQEQP KRDKDQIEKL AILGHHNSPL  300
RHVDLKDVLN YGEFVSCLTK EEQQQLLKYL PSVDISGPPD SLKSMFGSLQ FEENLSSFQK  360
LLAGGVFDNT ISGVKIEDCR ILKRFVLCNL IKSKWVEKYS LLKDVKSSNS ASISDVAGEY  420
NDIATGHSVN GKRPREGPYQ KFPGAKTIMK SPKGLMKTTY EHRELIDNDG LNFSPRSLFA  480
LPPDNSSLVL DSFHSGEATS DQDLLLDVPS SSSFPQAELL LPNTSFGAQA STSSSSVYPH  540
LGRP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015085914.10.0PREDICTED: GATA transcription factor 26-like
SwissprotQ8W4H11e-142GAT26_ARATH; GATA transcription factor 26
TrEMBLA0A068UJE30.0A0A068UJE3_COFCA; Uncharacterized protein
STRINGSolyc08g077960.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20892462