PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_16841_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 347aa    MW: 38807.4 Da    PI: 8.6034
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_16841_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.13.9e-3358111255
                               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                           prlrWtp+LH+ Fv+av++LGG+e+AtPk +l+lm+vkgLt++hvkSHLQ+YR+
  cra_locus_16841_iso_1_len_1362_ver_3  58 PRLRWTPDLHHTFVQAVQRLGGQERATPKLVLQLMNVKGLTIAHVKSHLQMYRS 111
                                           8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-3154112IPR009057Homeodomain-like
PROSITE profilePS5129413.94454114IPR017930Myb domain
SuperFamilySSF466891.13E-1556112IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-2458113IPR006447Myb domain, plants
PfamPF002498.5E-1059110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MESVEDGNSS DEVIVMKISS SSSSSNNSSV DDVIGDEKKI INSTSTAGVR QYKRSKVPRL  60
RWTPDLHHTF VQAVQRLGGQ ERATPKLVLQ LMNVKGLTIA HVKSHLQMYR SKKIDDHGQV  120
INERNNPMGN IDHILGKFWQ FPTLDRPGMT SSFSNNYSSY YDDNWSSKMM NWMAMAGHGC  180
TDQNVNNIRK PPESAAYHGR SLVEQIYARS TANAKKVPFF SGKYPNFTMQ ESKARTTTDS  240
EEEGKKEELL NVALKRKASN GNGNGIDLSL SLSMKNNNMR QEDEGIISKR KRTHWDIKEE  300
EEVDSNLLCL SLSSSSSAAS KTESYDSIDL NVSIKNPTLA STLDLTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1959113458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1959113458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1959113458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1959113458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1959113458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1959113458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1959113458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1959113458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1288293KRKRTH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027090439.13e-67uncharacterized protein LOC113711467 isoform X2
RefseqXP_027174711.13e-68uncharacterized protein LOC113774362
TrEMBLA0A068ULT36e-66A0A068ULT3_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74502029