PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_15774_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 279aa    MW: 30287.8 Da    PI: 9.2243
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_15774_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1054.3e-333690155
                               G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                          kprlrWt +LHerFv+av++LGG++kAtPk++l++m++kgLtl+h+kSHLQkYRl
  cra_locus_15774_iso_2_len_1400_ver_3 36 KPRLRWTADLHERFVDAVTKLGGPDKATPKSVLRVMGLKGLTLYHLKSHLQKYRL 90
                                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-323391IPR009057Homeodomain-like
PROSITE profilePS5129412.6563393IPR017930Myb domain
TIGRFAMsTIGR015572.8E-243691IPR006447Myb domain, plants
SuperFamilySSF466893.94E-163693IPR009057Homeodomain-like
PfamPF002499.3E-93889IPR001005SANT/Myb domain
PfamPF143791.7E-24136182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MESMFGGGGG GMGGGCYPYE RNGNGGAAVV MTRDPKPRLR WTADLHERFV DAVTKLGGPD  60
KATPKSVLRV MGLKGLTLYH LKSHLQKYRL GQQAKKQNGA EQNKENSGDS FGQFSSQASA  120
SSSHSTRMNI EPGEIPITEA LKSQIEVQKR LQEQLEVQKK LQMRIEAQGK YLQTILEKAQ  180
KSLSVEANNG NNVEATRAEL SEFNLALSSL IENVKGEERK GGNVVDSRRK ICSSSSSYYG  240
AKDDDSNDVK LTVEGGGSIN FDLNTRSSSY DFIGNSGAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-193689154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-193689154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-193689154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-193689154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027084214.11e-128myb family transcription factor PHL11-like
SwissprotC0SVS46e-81PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A068UVY11e-125A0A068UVY1_COFCA; Uncharacterized protein
STRINGEOY252821e-103(Theobroma cacao)
STRINGSolyc08g076010.2.11e-103(Solanum lycopersicum)
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]