PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_15373_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 275aa    MW: 29397.6 Da    PI: 9.4947
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_15373_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.91.5e-3067120155
                               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                           +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  cra_locus_15373_iso_1_len_1695_ver_3  67 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 120
                                           59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.42E-2064124IPR009057Homeodomain-like
PROSITE profilePS5129411.05964123IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.9E-3166125IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-2468120IPR006447Myb domain, plants
PfamPF002499.9E-870119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
HHHHHHHHQP QPPPPPPPPA SQAQNTPSSQ PNSSAEFDSS ELGGNGGGSG GTGAASGGEE  60
PARTLKRPRL VWTPQLHKRF VDAVAHLGIK NAVPKTIMQL MSVDGLTREN VASHLQKYRL  120
YLKRMQGISN GGGGGGINGN ASMSAAGASD TDHLFASSPV PAHFLHPGRP NSDHYLPFVP  180
VTAMPPHHQM AAVVGHHPHH QQLQQQFRHF GTSPPNGQFE HPFLSRQSQP QPVQRMGTAL  240
HNSTSGMPSY VEDVESATAA SNGRKVLTLF PTGDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A5e-3267123157Transcription factor LUX
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027072991.11e-123transcription factor MYBC1-like
RefseqXP_027175468.11e-123transcription factor MYBC1-like
TrEMBLA0A068UCH01e-121A0A068UCH0_COFCA; Uncharacterized protein
STRINGXP_009790047.11e-116(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24322354