PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1511_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family EIL
Protein Properties Length: 426aa    MW: 48335.5 Da    PI: 5.7974
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1511_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3480.51e-146423371299
                                          XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                                 EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvY 74 
                                          +el++rmw+d+m+lkrlke++k     ke  ++a+k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvY
  cra_locus_1511_iso_3_len_1881_ver_3  42 DELERRMWRDKMRLKRLKEMNKG----KEG-IDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVY 110
                                          79*******************98....788.******************************************* PP

                                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHH CS
                                 EIN3  75 giipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLL 148
                                          giipekgkpv+gasd+Lr+WWk+kv+fdrngpaai+ky a+n i+++ ++ +     ++h+l+elqDTtlgSLL
  cra_locus_1511_iso_3_len_1881_ver_3 111 GIIPEKGKPVSGASDNLREWWKDKVRFDRNGPAAIAKYLADNSIPGKTEGTNP-VGPTPHTLQELQDTTLGSLL 183
                                          ***********************************************999977.99****************** PP

                                          HHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHH CS
                                 EIN3 149 salmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptie 222
                                          salmqhcdppqrrfplekgv+pPWWPtG+e+ww++lgl+kdqg+ppykkphdlkkawkv+vLtavikhmsp+i+
  cra_locus_1511_iso_3_len_1881_ver_3 184 SALMQHCDPPQRRFPLEKGVPPPWWPTGNEEWWPQLGLQKDQGPPPYKKPHDLKKAWKVGVLTAVIKHMSPDIA 257
                                          ************************************************************************** PP

                                          HHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.XXXXXXXXXXXXXXXXXXXX.XXXXXX. CS
                                 EIN3 223 eirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.slrkqspkvtlsceqkedve.gkkeski 292
                                          +ir+l+rqsk+lqdkm+akes+++l+++nqee ++++++++  ++ s++ +s ++ +++ +++dve ++++++ 
  cra_locus_1511_iso_3_len_1881_ver_3 258 KIRKLVRQSKCLQDKMTAKESATWLAIINQEEVLARELYPDrcPPlSSSGGSGSFAINDTSEYDVEgVEDDPNF 331
                                          *****************************************864456677****************65666664 PP

                                          XXXXXXX CS
                                 EIN3 293 khvqavk 299
                                                k
  cra_locus_1511_iso_3_len_1881_ver_3 332 DXP-RAK 337
                                          433.333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048736.0E-13142289No hitNo description
Gene3DG3DSA:1.10.3180.101.4E-76163299IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167689.55E-63168292IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MGFCGDLDFF SAPLKEPDVE APNNEQEPVV DDDYSDDEID VDELERRMWR DKMRLKRLKE  60
MNKGKEGIDA AKQRQSQEQA RRKKMSRAQD GILKYMLKMM EVCKAQGFVY GIIPEKGKPV  120
SGASDNLREW WKDKVRFDRN GPAAIAKYLA DNSIPGKTEG TNPVGPTPHT LQELQDTTLG  180
SLLSALMQHC DPPQRRFPLE KGVPPPWWPT GNEEWWPQLG LQKDQGPPPY KKPHDLKKAW  240
KVGVLTAVIK HMSPDIAKIR KLVRQSKCLQ DKMTAKESAT WLAIINQEEV LARELYPDRC  300
PPLSSSGGSG SFAINDTSEY DVEGVEDDPN FDXPRAKLAH GRAMFQPGDR YEDGTMQPTN  360
RSMFHQGDRF DQCKMLNSPF NTNGNETFQF MFGSPFNIPS VDFSEGLPGV SRDNIVPKQD  420
IPIWYP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A3e-851672982133Protein ETHYLENE INSENSITIVE 3
4zds_B3e-851672982133Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801714.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
RefseqXP_016491027.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A068VEZ00.0A0A068VEZ0_COFCA; Uncharacterized protein
STRINGGLYMA20G12250.10.0(Glycine max)