PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1511_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family EIL
Protein Properties Length: 322aa    MW: 36429.6 Da    PI: 4.7432
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1511_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN329.99.8e-102109274353
                                          XXXXXXXXXXXXXXXXXX.XXXXXXXXXX..............................XXXXXXXXXXXXXXX CS
                                 EIN3 274 vtlsceqkedvegkkeskikhvqavktta..............................gfpvvrkrkkkpses 317
                                          + +++ +++dveg ++    +vq++k  +                              ++++ rkrk ++ + 
  cra_locus_1511_iso_2_len_1299_ver_3   2 FAINDTSEYDVEGVEDDPNFDVQEQKPSNlhllnmaadrfkdrlpgqpqphvikdellnNLDFGRKRK-PTNDL 74 
                                          678999******666666699******99**************************************9.77777 PP

                                          XXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
                                 EIN3 318 akvsskevsrtcqssqfrgsetelifadknsisqne 353
                                          +++++++   tc+  q+++se +++f+d++ +++++
  cra_locus_1511_iso_2_len_1299_ver_3  75 NIMMDHK-FFTCEFLQCPHSELRHGFQDRSTRDNHQ 109
                                          7777775.6*************************98 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
SFAINDTSEY DVEGVEDDPN FDVQEQKPSN LHLLNMAADR FKDRLPGQPQ PHVIKDELLN  60
NLDFGRKRKP TNDLNIMMDH KFFTCEFLQC PHSELRHGFQ DRSTRDNHQL TCPFRNSSQF  120
GVSNFHVNEV KPMVFPQQFV QSKAAAMPVN SNPPPFIDLS GLGVPEDGQR MINDLMSLYD  180
TNVQPHKNSD SGTGAVVKEQ PPLTQPGIQC QPDNYLQGQG LMMEAGNIFD DANLAHGRAM  240
FQPGDRYEDG TMQPTNRSMF HQGDRFDQCK MLNSPFNTNG NETFQFMFGS PFNIPSVDFS  300
EGLPGVSRDN IVPKQDIPIW YP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080515.11e-127PREDICTED: protein ETHYLENE INSENSITIVE 3
RefseqXP_011080514.11e-127PREDICTED: protein ETHYLENE INSENSITIVE 3
RefseqXP_009587969.11e-127PREDICTED: protein ETHYLENE INSENSITIVE 3-like
RefseqXP_016495136.11e-127PREDICTED: protein ETHYLENE INSENSITIVE 3-like
RefseqXP_016495135.11e-127PREDICTED: protein ETHYLENE INSENSITIVE 3-like
TrEMBLA0A068VEZ01e-171A0A068VEZ0_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000224761e-115(Solanum tuberosum)