PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_15024_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family Dof
Protein Properties Length: 297aa    MW: 31907.4 Da    PI: 8.968
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_15024_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-393191262
                               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                         ke+al+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+++
  cra_locus_15024_iso_1_len_945_ver_3 31 KEAALNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGGSRKNKHTT 91
                                         67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-262383IPR003851Zinc finger, Dof-type
PfamPF027018.7E-343489IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9943589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
GGGGGGGGAG AGALNSKSGS YERKAIIRPQ KEAALNCPRC NSTNTKFCYY NNYSLTQPRY  60
FCKTCRRYWT EGGTLRNVPV GGGSRKNKHT TSRSSSSSSN PHLKKLNPDL THNPNKIIPH  120
QPHHDLNLAY NPVPPPPKSL VHDYGIISGG GGGAGGFLNF PMRHNLPELE LLKVGSSSLS  180
SLMSMPLSDC NNSIFYPSSS SSSEIPNYKF NFSLDGSGVE NNGNYGISVQ DNQPVVLHIR  240
GGGDDAAAGR SLFLPYEELN LKTDHHEIED QRRNKGESTT TGYCWNGMLG GAAGSTW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGVIT_16s0098g01420.t012e-49(Vitis vinifera)