PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_14938_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 309aa    MW: 33941.1 Da    PI: 6.4277
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_14938_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.3e-144892347
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                          +WT+eE+ l++ + ++lG+g+W+ Iar + + Rt+ q+ s+ qky
  cra_locus_14938_iso_1_len_1178_ver_3 48 PWTEEEHRLFLLGLQKLGKGDWRGIARNFVTSRTPTQVASHAQKY 92
                                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7094197IPR017930Myb domain
SMARTSM007174.7E-114595IPR001005SANT/Myb domain
TIGRFAMsTIGR015575.1E-184696IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.609.2E-124791IPR009057Homeodomain-like
SuperFamilySSF466892.8E-164798IPR009057Homeodomain-like
PfamPF002491.8E-114892IPR001005SANT/Myb domain
CDDcd001673.66E-104893No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
XLYESNMSNK DCSAVAEARC CTHRARHSAS LVMTGGSKTF NLFFAGVPWT EEEHRLFLLG  60
LQKLGKGDWR GIARNFVTSR TPTQVASHAQ KYFIRQSNAT RRKRRSSLFD MVPEAGDPLA  120
LPEEQQYMLP PQVVDSSKEQ LSVPHSHTGE DENEKSIPSL DLSLKRDVEP METTPSESVE  180
ETKEIVTPSP EIPPVFPSFF PAYIPVPFPI WPSNMNFQED RGAEVSRHKI LKPIPVVPKE  240
PVNVDELVGM SHLSLGDAAA AAAGQAESLS SSLSLKLTGE PSTRQSAFHA STPVKETTIA  300
KGESSIKAV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626737.11e-113PREDICTED: transcription factor MYB1R1
TrEMBLA0A068TPK61e-121A0A068TPK6_COFCA; Uncharacterized protein
STRINGSolyc12g044610.1.11e-111(Solanum lycopersicum)