PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_14377_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 300aa    MW: 34023.5 Da    PI: 4.7581
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_14377_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-1758103148
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           rg++++eE+ ++v+++ +lG++ W++I+++++ gRt++++k++w+++l
  cra_locus_14377_iso_1_len_1412_ver_3  58 RGPFSPEEENIIVRLHSMLGNK-WAAISSHLP-GRTDNEIKNFWNSHL 103
                                           89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.4952IPR017877Myb-like domain
SuperFamilySSF466892.7E-211199IPR009057Homeodomain-like
SMARTSM007179.71354IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-111559IPR009057Homeodomain-like
PROSITE profilePS5129426.48353107IPR017930Myb domain
SMARTSM007172.9E-1757105IPR001005SANT/Myb domain
PfamPF002491.4E-1658103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2760106IPR009057Homeodomain-like
CDDcd001671.22E-1160103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGRSPCCDKG GVKKGAWTPE EDKILVDYIN KXWAWYLAIS SKTCGLRWTN YLRPDIKRGP  60
FSPEEENIIV RLHSMLGNKW AAISSHLPGR TDNEIKNFWN SHLKKRATAS MDQSSYQPSF  120
FSESSDDANL ESQSTQHMVQ WERATLEAEI QLSKDPLLLN SQSAVKTEND YFLRLWNSEV  180
GESFRKVNDY EVACQSPVSQ VSSSTRDESS SGVTIHTNDP PRVLLSPART TNTQKHAENV  240
SVKKDPEDHL ILGSESSKSY ELDESSDATM KLLLDFPQGD EMEYLQEPVE DVSIYLQDPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-20141077108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090267.11e-96PREDICTED: transcription factor MYB3-like
SwissprotQ9SCU72e-43MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A068UAM31e-125A0A068UAM3_COFCA; Uncharacterized protein
STRINGVIT_16s0050g00070.t015e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154