PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_14207_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family Dof
Protein Properties Length: 266aa    MW: 26988.8 Da    PI: 8.0032
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_14207_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.3e-392684361
                                zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                           ++l+cprCdstntkfCyynny+lsqPr+fCk+CrryWt+GG+lrnvPvGgg+rk+ ++
  cra_locus_14207_iso_1_len_1376_ver_3 26 PEHLPCPRCDSTNTKFCYYNNYNLSQPRHFCKSCRRYWTRGGTLRNVPVGGGSRKSGSA 84
                                          57899**************************************************9766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-212574IPR003851Zinc finger, Dof-type
PfamPF027012.2E-332881IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3572983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MSTSENINQD HRPVRLSTMP TRPTEPEHLP CPRCDSTNTK FCYYNNYNLS QPRHFCKSCR  60
RYWTRGGTLR NVPVGGGSRK SGSASSNKRP RPNSTSSATT TTTTSAASSS SDMTTPLHAT  120
PVSMVSQMGA GSVHMGGGSG SFAGCDVNLN EAVPEPANFG SFAAGAYLPP FGGGGGFGLG  180
TGPGLHGMSF GLGMMDWPME SVVVVGGNGS VGAGSGEGGA GGSGSTSSGG CNTWQINGVE  240
GGLGGDGPDC FGWPDLAISM SGKGLK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18791KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAPTransfer from AT3G50410Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592897.12e-53PREDICTED: dof zinc finger protein DOF3.4-like
RefseqXP_016447560.12e-53PREDICTED: dof zinc finger protein DOF3.4-like
TrEMBLB9HEE81e-52B9HEE8_POPTR; DNA binding with one finger 5 family protein
STRINGPOPTR_0007s11790.14e-52(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419