PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1383_iso_6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 378aa    MW: 42598.1 Da    PI: 7.48
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1383_iso_6genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.21.8e-28188242156
                              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                          k +++WtpeLH++Fv+aveqL G ++A+P++ilelmkv+gLt+++v+SHLQkYR++
  cra_locus_1383_iso_6_len_1908_ver_3 188 KSKVDWTPELHKKFVQAVEQL-GVDQAIPSRILELMKVEGLTRHNVASHLQKYRMH 242
                                          6799*****************.********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.776185244IPR017930Myb domain
SuperFamilySSF466892.87E-19186245IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-28186245IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-25188242IPR006447Myb domain, plants
PfamPF002495.8E-9191240IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0045454Biological Processcell redox homeostasis
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016491Molecular Functionoxidoreductase activity
GO:0050660Molecular Functionflavin adenine dinucleotide binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
XIWQHVVHKA FNAGGEDVSK SLKPVKDSVI SMLQLQLEKG VIDKQVCVKE ELRPEQENNH  60
DQLSGSDKYP APSTPQLKQG ERSLDDRDCH DQTNFSAEPD SGDHDGECKS VDTTAGNSIS  120
ESTTRSSPPP VEAVIKEEHE STYGGRNQKN AASSEDKDHT SNTTSNAVEP NRVSSRHDSC  180
GTKASKKKSK VDWTPELHKK FVQAVEQLGV DQAIPSRILE LMKVEGLTRH NVASHLQKYR  240
MHRRHILPKE DERKWPRLGD SAQRNHYAQK PVMAYPPYHP SQTLPAGQIY PAWVPPGSYP  300
NGVHMWGSPY YPGWQLPAES WQWRPYSGMH ADTWGCPVMP PPGSCPPFPR NDFFHSTREN  360
QYRSNVPLNS CDLNPQKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A7e-17188242155Transcription factor LUX
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027181008.10.0two-component response regulator-like APRR2 isoform X5
TrEMBLA0A068UXG71e-178A0A068UXG7_COFCA; Uncharacterized protein
STRINGVIT_02s0012g00570.t011e-145(Vitis vinifera)