PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_13549_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 388aa    MW: 43206.8 Da    PI: 8.9009
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_13549_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like986.9e-31235290156
                               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                           k+r+ W+peLH+rFv+a++qLGG+++AtPk+i+ lm+v +Lt+++vkSHLQkYRl+
  cra_locus_13549_iso_1_len_1440_ver_3 235 KQRRSWSPELHRRFVNALQQLGGPKVATPKQIRGLMQVADLTNDEVKSHLQKYRLH 290
                                           79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.707232292IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-27232294IPR009057Homeodomain-like
SuperFamilySSF466894.84E-16232293IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-26235290IPR006447Myb domain, plants
PfamPF002498.2E-7237288IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MGLASNELNS KSGYGFVQKS ISEFLQEIAV IQENGKKLAK INGFVFELEN EMKKIRVFKR  60
ELPVCMLLLG DAIEQLKEEG NRCKGRKGAM VEELIPSGRA KESIIDLNEK KNWMSSAQLW  120
TPTAPVEYDD NCRNLRFKDS FFLYPNSMNQ EIDNGIGKRT QLGSSWNVIN NRGGAFVPFQ  180
GATIQGDDLV GNGLTLSQPV ARMSSFGGGG TSSQQAILPE QKEQVQEKEQ QQQRKQRRSW  240
SPELHRRFVN ALQQLGGPKV ATPKQIRGLM QVADLTNDEV KSHLQKYRLH VRKMASMSGT  300
SSSSLNLNID DGLRRRYGMM NGENFKTTAQ SSCSPEGPLS YMGGSSLSKG VSVSLTIAGT  360
ESFEEEEEDD TKSESYCWKL GNAAHRSR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA84972229