PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_13318_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family Dof
Protein Properties Length: 321aa    MW: 35143.7 Da    PI: 7.2497
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_13318_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.86.3e-3563118459
                                zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                                           + l+cprC stntkfCyynny+ sqPr+fCk+C+r+WtkGG+lrnvPvGggr++++
  cra_locus_13318_iso_1_len_1216_ver_3  63 EVLNCPRCGSTNTKFCYYNNYNKSQPRHFCKGCKRHWTKGGTLRNVPVGGGRKNKR 118
                                           6789**********************************************976655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2363118IPR003851Zinc finger, Dof-type
PfamPF027015.6E-3164117IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.18665119IPR003851Zinc finger, Dof-type
PROSITE patternPS01361067103IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGVSTKQASL DHETLDFWSP TLMESSSAAA AAETGDHDDQ LPKPPQQPTT RRQQQQQQQX  60
KMEVLNCPRC GSTNTKFCYY NNYNKSQPRH FCKGCKRHWT KGGTLRNVPV GGGRKNKRLK  120
PSPGLTTPAT GLGLTPSQSQ NVPLQRQDWS KGEFAHKLVV TRDHSQQNGH MFPIGHDKDI  180
ISDSILFKAM INGSSKNSLG HDDPMINAYK GTSTSNSSDQ NLQLCFSSLN PLESIQSGVP  240
SFFNQSLING YDLGMESSTI TTVSNPAAGA SSIFGEGWQV PSKLSSGSSS VVAEMGNYSW  300
NWNEIDTLVS ADDLNIPWPD E
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033