PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11823_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 374aa    MW: 40940.6 Da    PI: 7.8412
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11823_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-332680155
                               G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                          kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  cra_locus_11823_iso_4_len_1679_ver_3 26 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 80
                                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-322381IPR009057Homeodomain-like
PROSITE profilePS5129412.3472383IPR017930Myb domain
SuperFamilySSF466891.74E-162581IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-232681IPR006447Myb domain, plants
PfamPF002491.2E-72878IPR001005SANT/Myb domain
PfamPF143792.8E-21123162IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MNTAHHERPS MCVQGDSGLV LTTDPKPRLR WTVELHERFV DAVTQLGGPD KATPKTIMRV  60
MGVKGLTLYH LKSHLQKFRL GKQPHKEFSD HPIKDGERAS SLELQRNTSA SSSGMIGRSM  120
NEMQMEVQRR IHEQLEVQRH LQLRIEAQGK YMQTILEKAC QTLAGENLSS SSAAYNNINN  180
KGLIGDFNFP SLQDLSIYGG GGGAADQQQQ QLQLHHEQQQ SDHGFVECLA GGKKRPNPNP  240
YGGGGGGTSK SPLMMWSSAD DLRLQELAGT AAATSCLGGS SSSQDDHHHH HQIQIAPHLS  300
LDHRNNNNEH LDSVSSDINY DTKPNMLMAG SSDQHNINAG EKNAGTKLER PSPRRAGSER  360
QMVSAGAGRN SPFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-182682157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-182682157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-182682157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-182682157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027063491.11e-142myb family transcription factor APL-like isoform X3
SwissprotQ9SAK51e-114APL_ARATH; Myb family transcription factor APL
TrEMBLA0A1S3TY391e-134A0A1S3TY39_VIGRR; myb family transcription factor APL isoform X3
STRINGevm.model.supercontig_32.941e-136(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA79422231
Publications ? help Back to Top
  1. Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R
    Vascular gene expression: a hypothesis.
    Front Plant Sci, 2013. 4: p. 261
    [PMID:23882276]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kondo Y, et al.
    Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells.
    Plant Cell, 2016. 28(6): p. 1250-62
    [PMID:27194709]
  4. Shibuta M,Abe M
    FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells.
    Plant Cell Physiol., 2017. 58(11): p. 2017-2025
    [PMID:29036620]