PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11823_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 336aa    MW: 36526.4 Da    PI: 6.9957
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11823_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like74.91.1e-232668143
                               G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtl 43
                                          kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLt 
  cra_locus_11823_iso_2_len_1564_ver_3 26 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTX 68
                                          79***************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-212367IPR009057Homeodomain-like
SuperFamilySSF466894.3E-92568IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-152668IPR006447Myb domain, plants
PfamPF143792.4E-2185124IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MNTAHHERPS MCVQGDSGLV LTTDPKPRLR WTVELHERFV DAVTQLGGPD KATPKTIMRV  60
MGVKGLTXLP SQEPSGMIGR SMNEMQMEVQ RRIHEQLEVQ RHLQLRIEAQ GKYMQTILEK  120
ACQTLAGENL SSSSAAYNNI NNKGLIGDFN FPSLQDLSIY GGGGGAADQQ QQQLQLHHEQ  180
QQSDHGFVEC LAGGKKRPNP NPYGGGGGGT SKSPLMMWSS ADDLRLQELA GTAAATSCLG  240
GSSSSQDDHH HHHQIQIAPH LSLDHRNNNN EHLDSVSSDI NYDTKPNMLM AGSSDQHNIN  300
AGEKNAGTKL ERPSPRRAGS ERQMVSAGAG RNSPFG
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027063492.11e-104myb family transcription factor APL-like isoform X4
SwissprotQ9SAK52e-80APL_ARATH; Myb family transcription factor APL
TrEMBLA0A2G9G9Z52e-99A0A2G9G9Z5_9LAMI; Uncharacterized protein
STRINGXP_004293816.11e-100(Fragaria vesca)
Publications ? help Back to Top
  1. Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R
    Vascular gene expression: a hypothesis.
    Front Plant Sci, 2013. 4: p. 261
    [PMID:23882276]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kondo Y, et al.
    Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells.
    Plant Cell, 2016. 28(6): p. 1250-62
    [PMID:27194709]
  4. Shibuta M,Abe M
    FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells.
    Plant Cell Physiol., 2017. 58(11): p. 2017-2025
    [PMID:29036620]