PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11598_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 414aa    MW: 46043.5 Da    PI: 7.3045
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11598_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-334599155
                               G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                          kprl+Wtp+LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  cra_locus_11598_iso_4_len_1652_ver_3 45 KPRLKWTPDLHERFIEAVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 99
                                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3842102IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-3143100IPR009057Homeodomain-like
SuperFamilySSF466898.96E-1744100IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-2445100IPR006447Myb domain, plants
PfamPF002492.5E-104798IPR001005SANT/Myb domain
PfamPF143791.2E-15144190IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MYPHHHQGKN IHASSRMSIP PERHLFLQGG NGPGDSGLVL STDAKPRLKW TPDLHERFIE  60
AVNQLGGADK ATPKSVLKLM GIQGLTLYHL KSHLQKYRLS KNLHGQANSG GNKSPAAAEE  120
RISEGSGTQT SNSSIAPQTN KNLHIGEAIQ MQIEVQRRLH EQLRCNGTYS CXIEAQGKYL  180
QAVLEKAQET LGRQNLGSMG LEAAKVQISE LVSKVSTQCL NSAFSDVKEL SGLCPQQTQT  240
PQPTDCSMDS CLTSCEGPLR DQDMHNNKMA IGTLNFKTVM ESKNISNEPS LRQTEQRWCE  300
DLNDKRRFLL SMNEEAEKEC AMEKSCSNLS MSIGLQGGWN TNIYSEKGIT ETNRDTKFFD  360
QPCSRHDAVP TVKQRSSQEY KMPFFAPKLD LNTDDETDAA SKCKQFDLNG FSWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2244101158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2244101158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-2245101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-2245101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-2245101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-2245101157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2244101158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2244101158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2244101158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2244101158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2244101158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2244101158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027065684.10.0myb-related protein 2-like isoform X1
RefseqXP_027069547.10.0myb-related protein 2-like isoform X1
RefseqXP_027156141.10.0myb-related protein 2-like isoform X1
RefseqXP_027173590.10.0myb-related protein 2-like isoform X1
SwissprotQ9SQQ91e-136PHL9_ARATH; Myb-related protein 2
TrEMBLA0A068V4H40.0A0A068V4H4_COFCA; Uncharacterized protein
STRINGXP_002525443.10.0(Ricinus communis)
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]