PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11598_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 429aa    MW: 47957.1 Da    PI: 7.8669
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11598_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like54.62.3e-172342355
                               G2-like 23 GsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                          G++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  cra_locus_11598_iso_2_len_1587_ver_3  2 GADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 34
                                          99******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.94E-6235IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-11235IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.7E-15235IPR009057Homeodomain-like
PfamPF143797.7E-979103IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PfamPF143799.7E-11180205IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
XGADKATPKS VLKLMGIQGL TLYHLKSHLQ KYRLSKNLHG QANSGGNKSP AAAEERISEG  60
SGTQTSNSSI APQTNKNLHI GEAIQMQIEV QRRLHEQLEX IARLIKTKYP IHKHYIIQGQ  120
NASKHNSDAT HANCKSFLSF XEAIVENPIG KKLFFILCLS VTNSIIFFAT SEISSXMIXV  180
QRHLQLRIEA QGKYLQAVLE KAQETLGRQN LGSMGLEAAK VQISELVSKV STQCLNSAFS  240
DVKELSGLCP QQTQTPQPTD CSMDSCLTSC EGPLRDQDMH NNKMAIGTLN FKTVMESKNI  300
SNEPSLRQTE QRWCEDLNDK RRFLLSMNEE AEKECAMEKS CSNLSMSIGL QGGWNTNIYS  360
EKGITETNRD TKFFDQPCSR HDAVPTVKQR SSQEYKMPFF APKLDLNTDD ETDAASKCKQ  420
FDLNGFSWS
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019153103.11e-109PREDICTED: myb-related protein 2-like isoform X1
RefseqXP_019153122.11e-110PREDICTED: myb-related protein 2-like isoform X3
RefseqXP_019153130.11e-110PREDICTED: myb-related protein 2-like isoform X3
SwissprotQ9SQQ91e-54PHL9_ARATH; Myb-related protein 2
STRINGXP_009619712.19e-98(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]