PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11598_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 205aa    MW: 23164.6 Da    PI: 6.6226
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11598_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like54.42.8e-174575131
                               G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPkt 31
                                          kprl+Wtp+LHerF+eav+qLGG++kAtPkt
  cra_locus_11598_iso_1_len_1025_ver_3 45 KPRLKWTPDLHERFIEAVNQLGGADKATPKT 75
                                          79****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-134375IPR009057Homeodomain-like
SuperFamilySSF466895.73E-54475IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-114575IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MYPHHHQGKN IHASSRMSIP PERHLFLQGG NGPGDSGLVL STDAKPRLKW TPDLHERFIE  60
AVNQLGGADK ATPKTSAMSP AYXQTEQRWC EDLNDKRRFL LSMNEEAEKE CAMEKSCSNL  120
SMSIGLQGGW NTNIYSEKGI TETNRDTKFF DQPCSRHDAV PTVKQRSSQE YKMPFFAPKL  180
DLNTDDETDA ASKCKQFDLN GFSWS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023929228.12e-43myb-related protein 2-like isoform X1
RefseqXP_023929229.12e-43myb-related protein 2-like isoform X1
RefseqXP_023929230.11e-43myb-related protein 2-like isoform X2
RefseqXP_023929231.11e-43myb-related protein 2-like isoform X2
TrEMBLA0A2K1Y1Q12e-41A0A2K1Y1Q1_POPTR; Uncharacterized protein
STRINGPOPTR_0013s05670.13e-42(Populus trichocarpa)