PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11392_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family Dof
Protein Properties Length: 348aa    MW: 37791.6 Da    PI: 8.6525
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11392_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.7e-3955115262
                                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                           +++ lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ +
  cra_locus_11392_iso_2_len_1257_ver_3  55 QQQPLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRIK 115
                                           6899******************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.3E-3357113IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52559113IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-2859113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
SERVVEKKEM LGNCEKKNEW AANQIDEKGL IMAASSSANK VLLMEKTAAQ DQNQQQQPLK  60
CPRCDSSNTK FCYYNNYSLS QPRHFCKACK RYWTRGGTLR NVPVGGGCRK NKRIKRPSSS  120
SSTNTNTTTE VNVTSSIITN PSSSNIQTGH IDLSSSSSSA AGHINPLFYS LFTNPSDMNL  180
PYPRFNSSSG GFDSQMNGIN NGLGFSSGLL ASDVSSHEFH RSNGFLSSYP INIGSNSSST  240
STMASLLASS LHQQKLISPG NNNNNYQQQF GGANYEELAA ARNGNVKMEE NSWNVPNHHQ  300
NHNIEVQMVN SSSDANNSLL WNAANGIGAV ANWLDPNSNI GSSVTSLI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025580.11e-81F-box family protein, putative
TrEMBLA0A068TVZ05e-85A0A068TVZ0_COFCA; Uncharacterized protein
STRINGVIT_10s0003g00040.t014e-79(Vitis vinifera)