PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11392_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family Dof
Protein Properties Length: 349aa    MW: 37910.4 Da    PI: 8.6525
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11392_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.8e-3956116262
                                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                           +++ lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ +
  cra_locus_11392_iso_1_len_1258_ver_3  56 QQQPLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRIK 116
                                           6899******************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.3E-3358114IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-2860114IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52560114IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106298IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
XSERVVEKKE MLGNCEKKNE WAANQIDEKG LIMAASSSAN KVLLMEKTAA QDQNQQQQPL  60
KCPRCDSSNT KFCYYNNYSL SQPRHFCKAC KRYWTRGGTL RNVPVGGGCR KNKRIKRPSS  120
SSSTNTNTTT EVNVTSSIIT NPSSSNIQTG HIDLSSSSSS AAGHINPLFY SLFTNPSDMN  180
LPYPRFNSSS GGFDSQMNGI NNGLGFSSGL LASDVSSHEF HRSNGFLSSY PINIGSNSSS  240
TSTMASLLAS SLHQQKLISP GNNNNNYQQQ FGGANYEELA AARNGNVKME ENSWNVPNHH  300
QNHNIEVQMV NSSSDANNSL LWNAANGIGA VANWLDPNSN IGSSVTSLI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025580.11e-81F-box family protein, putative
TrEMBLA0A068TVZ06e-85A0A068TVZ0_COFCA; Uncharacterized protein
STRINGVIT_10s0003g00040.t015e-79(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419