PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11133_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family GATA
Protein Properties Length: 259aa    MW: 27935.6 Da    PI: 10.6058
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11133_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.71.4e-17160193134
                                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                           C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  cra_locus_11133_iso_4_len_1401_ver_3 160 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 193
                                           99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.556154190IPR000679Zinc finger, GATA-type
SMARTSM004012.2E-16154204IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.14E-15158217No hitNo description
Gene3DG3DSA:3.30.50.109.9E-15158191IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.63E-13159208No hitNo description
PROSITE patternPS003440160185IPR000679Zinc finger, GATA-type
PfamPF003202.9E-15160193IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MALTFVEDSF SGGGLTVGKE NSSVKETSHN KFHTSSPVSV LESSSSSSSS CSGGKVIPLG  60
SNHRGPQRAR SKRPRPATFN PRPAIRLITP TSSFCETPQP FLSSGVSSES ENFAESVPAR  120
KFPKPEATEQ KKKKKVKLAA PVGPLDTTNQ NTSQQAVRKC LHCEITKTPQ WRAGPMGPKT  180
LCNACGVRYK SGRLFPEYRP AASPTFIPSL HSNSHKKVLE MRNVDNTNKT NNGATPAATN  240
PSTGQRDVIA DVKPKIDYI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17175KRPRP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760862.11e-102PREDICTED: GATA transcription factor 8-like
RefseqXP_009760863.11e-102PREDICTED: GATA transcription factor 8-like
RefseqXP_016497965.11e-102PREDICTED: GATA transcription factor 8-like
RefseqXP_016497966.11e-102PREDICTED: GATA transcription factor 8-like
TrEMBLA0A068TWN21e-102A0A068TWN2_COFCA; Uncharacterized protein
STRINGVIT_13s0019g04390.t011e-91(Vitis vinifera)