PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11133_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family GATA
Protein Properties Length: 326aa    MW: 35370.6 Da    PI: 7.9015
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11133_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.31.9e-17227260134
                                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                           C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  cra_locus_11133_iso_2_len_1765_ver_3 227 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 260
                                           99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.3E-704314IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.556221257IPR000679Zinc finger, GATA-type
SMARTSM004012.2E-16221271IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.4E-14225258IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577164.66E-15225284No hitNo description
CDDcd002023.50E-13226275No hitNo description
PfamPF003204.0E-15227260IPR000679Zinc finger, GATA-type
PROSITE patternPS003440227252IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGPNFMDDMD CGSFFDNMDD LIEFPADNDC GNGLVGSGGD CKDFPSIWND ALPDADNIFP  60
GSNCNSASDL SAELSVPYED IIQLEWLSTF VKETSHNKFH TSSPVSVLES SSSSSSSCSG  120
GKVIPLGSNH RGPQRARSKR PRPATFNPRP AIRLITPTSS FCETPQPFLS SGVSSESENF  180
AESVPARKFP KPEATEQKKK KKVKLAAPVG PLDTTNQNTS QQAVRKCLHC EITKTPQWRA  240
GPMGPKTLCN ACGVRYKSGR LFPEYRPAAS PTFIPSLHSN SHKKVLEMRN VDNTNKTNNG  300
ATPAATNPST GQRDVIADVK PKIDYI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138142KRPRP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084325.11e-133PREDICTED: GATA transcription factor 8
TrEMBLA0A068TWN21e-145A0A068TWN2_COFCA; Uncharacterized protein
STRINGVIT_13s0019g04390.t011e-126(Vitis vinifera)